KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_158216Help
Entry
DICPUDRAFT_158216 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K14569  
ribosome biogenesis protein BMS1
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    DICPUDRAFT_158216
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1183 aa AA seqDB search
MDISKDTKKVHRVSKAGAKANKKKAAKLKRLEQNEALKGRNPKAFIANTSYASLKQQRRV
LDKEQKRINLPVIDRSGTAIETPPYVIAVVGPPQCGKTTLIRSLIKNYTRHSINEVKGPI
TIVAGKKRRLTFIECNNDLNSMIDTAKVADLVLLLIDASYGFEMETFEFLNILKTHGFPK
VIGVLTHLDGFKNNKKLKKTKKKFKDRFWTEIYEGAKLFYLSGVIHGKYPKVEIHNLARF
ISVANFVPLTWRNTHPYVYVDRFEDTTDPEVLRNNKKADRNICLYGYVRGTYLKPHMKVH
IPGSGDYIMKSITSMPDPCPLPQERKKTLNEKERLIYAPMCDIGNSIIFDKDAVYINIPD
NKLAFSKEVDESDEEGEGESMVKKLQNTQFSIDEKMKNSEFSLFSSKPTTIKANNTYTQI
EEISDREYYDEPDMPTNGTQKVEVKEDINGRVRRKVKFVDLKKNPTEYNSDDEGDEDDSD
AEEEEDEEEEEESRNEIAFDDEDDLQSDEEYYDPQNKGGNDEDEDDEEDEDEEEDEEEDD
DDEEEDEEEEEYDEETGESAKWKEKMKPNFTISNNPVNLTKLIYGDDLSNVNNKNSKKGN
DQDDDDFFTVRKGGFSSLKLSSDKGSAKDALDSAKYIHSTHDLKSEEIKELLKKKFVSKG
ELESVGAVGKNDSGDGEDQVLFGDFEDLETGKVYEAGSTQPKDSDEEDSDDEDKEKGSDD
DEESSDVEKEREKNKSKKQKQIEKINAKFEEGEKDYEGELNAEARRQREINEKEFEQDDQ
FYRTKYEGFPIGVYVRVEFEKIPCEFSEYFDPRYPVVVGGLLSNEENLGMINVNIKKHRW
HKKILKSNDPLIVSVGWRRFQTMVLYSTKDINGRNRMLKYTPEHMHCHASFYGPLTPPGT
AFAAFTNSNNNQASFRVSATGTVLDLDSSIDVVKKLKLIGHPDKILKKTCFVNGMFTSRL
EVAKFVGATIRTVSGIRGTIKKPLSHPEGAFRATFEDKLIPSDIVFLRTWYTVTPTKYYN
PVTSLLQEKKTSWQGMKTVGQLRYENNLSAPVKKDSSYEGLKVEREQKSFKQLKIPTKLQ
SQLPFEAKPKQRVIKNQDDILLSSRVNIVEPHEQQVADLMKRLQTIKDKKIEKEQQRRES
RAVETKKKQDKLDVEREKRQKQEKKRKSKLEALGKIKKKSKMG
NT seq 3552 nt NT seq  +upstreamnt  +downstreamnt
atggatataagtaaagatacgaaaaaagtacatagagttagtaaagctggtgctaaagca
aataaaaagaaagcagcaaaattaaagagattagaacaaaatgaggcattaaaaggaaga
aatccaaaggctttcattgccaatacatcatatgcatcattaaagcaacaacgtcgtgtt
ttagataaagaacaaaagagaatcaatttaccagttattgatagatcaggtacagcaatt
gaaaccccaccatatgttattgccgttgttggtccacctcaatgcggtaaaactacttta
attagatcattaatcaaaaactatactagacattcaattaacgaagttaaaggtccaatc
acaattgtagcaggtaaaaaacgtcgtcttacttttatcgagtgcaataacgacttaaac
tcaatgatagatacagcaaaagttgcagatttagttttacttcttatcgatgcatcatat
ggttttgaaatggaaactttcgaatttttaaacattctcaaaactcatggtttcccaaaa
gttattggtgtattaacccatttagatggtttcaaaaataataaaaaattaaaaaagacc
aaaaagaagtttaaggatagattttggactgaaatttacgaaggtgcaaaattattttac
ttatcaggtgtaattcacggcaaatatccaaaagttgaaattcataatttagcaagattt
atttcagttgccaattttgtaccattaacttggagaaatacacatccatatgtatatgtt
gatagatttgaagatacaactgacccagaagttttaagaaataataaaaaagccgataga
aatatttgtctttatggttatgttcgtggtacctatttgaaaccacatatgaaagttcat
atcccaggtagtggtgattatattatgaaatcaattacatcaatgccagatccatgtcct
ttaccacaagaaagaaaaaaaactcttaatgaaaaagaacgtcttatttatgctccaatg
tgcgatattggtaactctattattttcgataaagatgctgtatatattaatattccagat
aacaaattagctttttcaaaagaagttgatgaaagtgacgaggaaggtgaaggtgaaagt
atggtaaagaaacttcaaaatactcaattctcaattgatgaaaaaatgaaaaattcagaa
ttttctttattctcaagtaaaccaacaactattaaagcaaataatacatatactcaaatt
gaagagattagtgatagagaatattatgacgaaccagatatgccaacaaacggtactcaa
aaggttgaagttaaagaagatatcaatggtagagttagaagaaaggttaaatttgttgat
ttaaagaaaaatccaactgaatacaatagtgatgacgaaggtgatgaagatgatagcgat
gctgaagaagaagaagatgaagaagaagaggaggaatcaagaaatgaaattgcatttgat
gatgaagacgatttacaaagtgatgaagaatattacgatccacaaaataaaggtggaaat
gatgaagatgaggatgatgaagaggacgaagatgaagaagaagacgaagaagaagatgat
gatgacgaagaagaagatgaagaagaagaagagtatgacgaagaaactggtgaaagtgca
aaatggaaagaaaaaatgaaaccaaactttacaatttcaaataatccagttaatttaaca
aaactaatttatggtgatgatttatcaaatgtaaacaataagaatagtaaaaaaggaaac
gaccaagatgatgacgatttctttacagttagaaaaggtggttttagttcattaaaatta
agttcagataaaggttcagctaaagatgctttagattcagctaaatatatacattcaaca
cacgatcttaagagtgaagaaattaaagaattactcaaaaagaaatttgtttcaaaaggt
gaattagaatcagttggtgcagttggtaaaaacgattcaggtgatggtgaagatcaagta
ttatttggtgattttgaagatttagaaactggtaaagtttatgaagcaggctcaactcaa
ccaaaagatagtgatgaagaagattcagatgacgaagataaagaaaaaggttcagatgat
gatgaagaaagcagcgatgttgaaaaagaaagagaaaagaataaatcaaagaaacaaaaa
caaattgaaaagattaatgctaagtttgaagagggtgaaaaagattatgagggtgaatta
aatgcagaggccagacgtcaaagagaaattaatgaaaaagaattcgaacaagatgatcaa
ttttatcgtactaaatatgaaggtttcccaattggtgtttatgttagagtcgagtttgaa
aaaatcccatgcgagttctctgaatattttgacccaagatacccagtagtagtaggtggt
cttttaagtaatgaagaaaatcttggtatgattaacgtcaacatcaagaaacatcgttgg
cacaaaaagattttgaaatcaaacgatccacttattgtcagtgtcggttggcgtcgtttc
caaaccatggtattatactccaccaaagatattaatggccgtaatcgtatgcttaaatat
accccagagcatatgcattgtcacgccagtttttatggtccacttacacctccaggtact
gcctttgctgctttcaccaattcaaataataatcaagctagcttccgtgttagtgccact
ggtacagttttagatttagatagttcaatcgatgttgtaaagaaattgaaattaattggt
catccagataagattttaaagaaaacatgttttgtaaatggtatgtttaccagtcgtctt
gaagttgccaaatttgttggtgctactattcgtactgtatctggtattcgtggtaccatt
aagaaaccactttctcatccagaaggtgcattccgtgcaacattcgaagataaattaatt
ccatcagatattgtattccttcgtacttggtacactgtcaccccaactaaatattataat
ccagttacctcactcctccaagaaaagaagaccagctggcaaggtatgaagactgttggt
caattacgttacgaaaacaacttaagtgctccagttaaaaaagactcatcctatgaaggc
cttaaagttgaaagagaacaaaaatcatttaaacaacttaaaatcccaaccaaacttcaa
tcacaactcccattcgaagccaaaccaaaacaaagagttatcaaaaatcaagatgatatc
cttctttcaagtcgtgttaatattgtagaaccccacgaacaacaagttgcagacctcatg
aaacgtttacaaaccattaaagataaaaagattgaaaaagaacaacaaagaagagagagt
cgtgctgttgaaactaagaagaaacaagataaattggatgtagaaagagaaaagagacaa
aaacaagaaaagaagagaaaatcaaaattagaagctttaggtaaaattaaaaagaaatca
aaaatgggttaa

DBGET integrated database retrieval system