KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_158224Help
Entry
DICPUDRAFT_158224 CDS       T02090                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DICPUDRAFT_158224
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     DICPUDRAFT_158224
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 230 aa AA seqDB search
MDKNLQVYQENHIDNDDEEIYENRKGKAIIDTTKKREPLMQNQLVLENMQGSVKNLLECL
GEDTSREGLLKTPLRMSKALLFFTHGYEQSVDEVVGEAIFNENHHEMVVVRDIDIFSLCE
HHMVPFHGKCHIGYIPDQKVLGLSKLARIAEIFARRLQVQERLTRQIAQAIQTALNPMGV
AVVIEASHMCMVMRGVQKPGASTVTSSVCGIFEKDSRTRAEFFSLIKTSK
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaatttacaagtttaccaagaaaaccacatcgataatgatgatgaagaaatc
tatgaaaacagaaagggaaaagccatcattgacaccacaaagaaaagagaaccattaatg
caaaaccaactcgttttagaaaatatgcaaggttcagtcaaaaatcttttagaatgttta
ggtgaagatacatcaagagaaggtctcttaaaaactccattaagaatgtcaaaagcttta
ttatttttcactcacggttatgaacaatcagtagatgaagttgtcggtgaagctattttt
aacgaaaatcatcacgaaatggttgttgttagagatattgatattttttcactctgtgaa
catcacatggtaccattccatggtaaatgtcacattggttatattccagatcaaaaagtt
ttaggtttaagtaaattagcaagaattgctgaaattttcgccagaagacttcaagtacaa
gaaagattaactagacaaatcgcacaagctattcaaactgctcttaatccaatgggtgtt
gccgtcgtcattgaagcttcacatatgtgtatggttatgagaggtgttcaaaaaccaggt
gcctctacagtcacatcatcagtttgtggtatttttgaaaaagattcacgtacaagagct
gaattctttagtttaatcaaaacctcaaaataa

DBGET integrated database retrieval system