KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_158856Help
Entry
DICPUDRAFT_158856 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K06072  
deoxyhypusine monooxygenase [EC:1.14.99.29]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 319 aa AA seqDB search
METTPKIEVTPELVNGLKKTLLDVNEPIAKRFRSLFTLRNLNGPLSIDAMCEALNDKSAL
LRHEIAYCLGQMENDHALSVLIDLVKNHDEHPMVRHEAAEALGAIGNPIALETLKEHSTD
KVREVSETCQLALSRVEWYTENEPESIDNKVYLSVDPAPPLPTGTNHESLCKQFLNQELD
IFNRYRALFSLRDCGDEKSVLALCEGLKDSSALLKHEVAFVLGQLQHRAAIDSLTTCVLD
ESESAMVRHEAAEALGAIASTETVPLLEKLLHDKEPIVSESCAIALDVTEYFNNTEAFQY
ADGIKILLEKNHSSINTNN
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggaaactacaccaaaaatcgaagtaaccccagaattagttaatggtttaaaaaagaca
ttattagatgttaatgaaccaatcgccaaaagatttagatcattatttacattaagaaat
ttaaatggtccattatctattgatgctatgtgcgaagcattaaatgataaatcagcatta
ttaagacatgaaattgcatattgtttaggacaaatggaaaatgatcacgcattatcagtt
ttaatcgatttggttaaaaatcatgatgaacatccaatggttcgtcatgaagcagcagaa
gcattaggtgctattggtaacccaattgcattagaaacattaaaagaacattcaacagat
aaagttagagaagtttcagaaacatgtcaactagcattatcaagagtagaatggtataca
gaaaatgaaccagaatcaattgataataaagtatatctttcagttgatccagcaccacca
cttccaactggcaccaatcacgaatcactttgcaaacaatttttaaatcaagaattagat
attttcaatcgttatagagctttattttcacttcgtgattgtggtgatgaaaaatcagtt
ttagcattatgtgaaggtctcaaagatagcagtgcattattaaaacatgaagtcgccttt
gttttaggtcaacttcaacatcgtgccgccatcgattctttaactacctgtgttttagat
gaatcagaatctgctatggttcgtcacgaagctgctgaagctttaggtgctatcgcctca
actgaaactgtaccactcctcgaaaaacttttacacgataaagaaccaattgttagcgaa
tcttgtgccattgctttggatgttacagaatactttaacaacactgaggctttccaatat
gctgatggtattaaaattttattagaaaaaaatcattcttcaattaatacaaataattaa

DBGET integrated database retrieval system