KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_158856Help
Entry
DICPUDRAFT_158856 CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K06072  deoxyhypusine monooxygenase [EC:1.14.99.29]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Enzymes [BR:dpp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.29  deoxyhypusine monooxygenase
     DICPUDRAFT_158856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HEAT_2 HEAT_PBS HEAT Arm Vitellogenin_N DUF3385
Motif
Other DBs
NCBI-GeneID: 10505248
NCBI-ProteinID: XP_003293933
JGI: Dicpu1_158856
UniProt: F1A2N7
Position
Unknown
AA seq 319 aa AA seqDB search
METTPKIEVTPELVNGLKKTLLDVNEPIAKRFRSLFTLRNLNGPLSIDAMCEALNDKSAL
LRHEIAYCLGQMENDHALSVLIDLVKNHDEHPMVRHEAAEALGAIGNPIALETLKEHSTD
KVREVSETCQLALSRVEWYTENEPESIDNKVYLSVDPAPPLPTGTNHESLCKQFLNQELD
IFNRYRALFSLRDCGDEKSVLALCEGLKDSSALLKHEVAFVLGQLQHRAAIDSLTTCVLD
ESESAMVRHEAAEALGAIASTETVPLLEKLLHDKEPIVSESCAIALDVTEYFNNTEAFQY
ADGIKILLEKNHSSINTNN
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggaaactacaccaaaaatcgaagtaaccccagaattagttaatggtttaaaaaagaca
ttattagatgttaatgaaccaatcgccaaaagatttagatcattatttacattaagaaat
ttaaatggtccattatctattgatgctatgtgcgaagcattaaatgataaatcagcatta
ttaagacatgaaattgcatattgtttaggacaaatggaaaatgatcacgcattatcagtt
ttaatcgatttggttaaaaatcatgatgaacatccaatggttcgtcatgaagcagcagaa
gcattaggtgctattggtaacccaattgcattagaaacattaaaagaacattcaacagat
aaagttagagaagtttcagaaacatgtcaactagcattatcaagagtagaatggtataca
gaaaatgaaccagaatcaattgataataaagtatatctttcagttgatccagcaccacca
cttccaactggcaccaatcacgaatcactttgcaaacaatttttaaatcaagaattagat
attttcaatcgttatagagctttattttcacttcgtgattgtggtgatgaaaaatcagtt
ttagcattatgtgaaggtctcaaagatagcagtgcattattaaaacatgaagtcgccttt
gttttaggtcaacttcaacatcgtgccgccatcgattctttaactacctgtgttttagat
gaatcagaatctgctatggttcgtcacgaagctgctgaagctttaggtgctatcgcctca
actgaaactgtaccactcctcgaaaaacttttacacgataaagaaccaattgttagcgaa
tcttgtgccattgctttggatgttacagaatactttaacaacactgaggctttccaatat
gctgatggtattaaaattttattagaaaaaaatcattcttcaattaatacaaataattaa

DBGET integrated database retrieval system