KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_158914Help
Entry
DICPUDRAFT_158914 CDS       T02090                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    DICPUDRAFT_158914
Enzymes [BR:dpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     DICPUDRAFT_158914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 611 aa AA seqDB search
MSINSDSNNSSLRNSRNSLNNSLNNSLNNITPTASSINSSGNFSPKEFVTNVEDEDVLYE
NKQVEYKERLVTLSIKQSTLIIRYHDNNNFTKYLVADTIVGSDTTDKSVTIYSCIMNTID
ITKESRRRKQFKFTFKNSSEANRFSKNIDDLFLNILPRGNPKTRKIRVILNPKSGKKMSE
SIFNEINQLFSDSKIQVKKTVTKGPDHAKKIGFKFNAKKYDTIVFISGDGLFHEFINGLL
SRTDYEEAKKIPLALIPAGTGNGIACSIGLQDPMSCALAVIRGFTKPLDISVIQQNESKW
CSILSLTWGIVSDVDIESEKWRRLGELRLVLGAAIRILNLRIYKGKILYLPAIEISKNEM
AKIPKCSYSCEVCESDDAIQTISDIVSNPENNLTNPLQYSRSSLRRSLNNSGTITNIGLN
NSTDRSLDELSKEIEQKEEELKKSNNYNDNISEDQDDIEKPLMKSTEIYNVPTTKLPNQQ
FLKQSEQELLANGWKKLEGEFIGIVASTVSHLASDFIASPSAHLSDGLIDLVVIKSDKNL
SKAGLLSILTESSTGNHIKSDLIDQYKVHAMILDPSTEREGIIAVDGEKITYGRTSMECM
RGCINLICRSY
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgagtattaatagcgattcaaataatagtagtttaagaaatagtagaaatagtttaaat
aatagtttaaataatagtttgaataatattacaccaacagcaagtagtattaatagcagt
ggcaatttttctccaaaggagtttgtaaccaatgtcgaagatgaagatgtactctatgaa
aacaagcaagtagagtataaagaaagattggtgacattatcaattaagcaatctacactt
atcattagatatcatgacaataacaactttacaaaatatttagttgcagatacaattgtc
ggtagtgatactactgataaatctgtaaccatatattcctgtattatgaatacaatagac
attaccaaagaatcgagacgtagaaaacaatttaaatttactttcaaaaactctagcgaa
gcaaatagattcagtaaaaatatagacgatctatttttaaatattttaccaagaggtaat
ccaaaaactagaaagattagagtaattttaaatccaaaatctggtaaaaaaatgtcagaa
agtatatttaatgaaattaatcaattattttcggattcaaagattcaagtaaagaaaact
gtaaccaaaggaccagatcatgcaaaaaagattggatttaaatttaatgcaaagaaatat
gacacaattgtatttattagtggtgatggtttattccacgaatttattaatggtttatta
tctcgtaccgactatgaagaggctaaaaagattccattagcattaatacccgctggtact
ggcaatggtattgcttgctccataggtttacaagatccaatgtcatgtgctttagctgtt
attcgtggcttcaccaaaccattggatatctctgtaattcaacaaaatgaatccaaatgg
tgctctattttatctttaacttggggtatagttagcgatgttgatatcgaatctgaaaaa
tggcgtcgtttaggtgaattacgtttggtattaggtgctgctataagaattttaaatcta
cgtatctataagggtaaaattttatacttgccagcaatcgaaatttcaaaaaacgaaatg
gccaaaataccaaaatgctcctactcttgtgaagtatgcgagtctgatgatgctatccaa
accattagcgatatcgtttcaaacccagaaaacaatttaaccaatccattgcaatactct
agatcatcattaagaagatcattaaacaatagtggtaccattactaatataggcttaaac
aactcaaccgacagatcattggacgaactatcaaaagaaatcgaacaaaaagaagaggaa
cttaaaaaaagtaacaactataacgataacatttcagaggatcaagatgacattgaaaaa
ccattaatgaaatctaccgagatctacaatgtaccaactaccaaactaccaaatcaacaa
tttttaaagcaatcagaacaagagttattagcaaatggttggaaaaaattagaaggtgaa
tttattggtatcgttgcaagtacagtatcacatttagcttcagattttatcgcctcacca
agtgcacatctttcagatggtttaatagatttagtagttattaaaagtgataagaattta
agcaaagcaggcttgctatcaattttaacagaatcaagtacaggtaatcacatcaagagt
gatttaatcgatcaatataaagtacatgctatgattttagatccatcaactgaaagagaa
ggtattattgcagtagatggtgaaaaaatcacctatggtagaacctcaatggaatgtatg
agaggttgtataaatttaatttgtagatcttactaa

DBGET integrated database retrieval system