KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_25523Help
Entry
DICPUDRAFT_25523  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    DICPUDRAFT_25523
Messenger RNA biogenesis [BR:dpp03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     DICPUDRAFT_25523
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     DICPUDRAFT_25523
Translation factors [BR:dpp03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    DICPUDRAFT_25523
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 266 aa AA seqDB search
MVHLLSNTYYFYYMPKRPKTMNDYLAGLQCISGPIKTVEDFWSYYSHMIRPVDEFSQLSD
IYFFKEGIKPIWEDAENRDGGKFVVKTRRNYTSKWWEDLLLAFIGEQVDDVENINGIVIS
FRANDNNLIGIWNKNSEDNEKLLVSLKHLFKIDKLDYKPHFGRILKEEVFQNNKNENNSN
SGSMGSSGLLSDSGNVSLDAPSPDTFDFMKPSSLNSISSPTNTPFQPYLPFGQPSSSSSS
SSSSQPSQPHSFFSFNNLDFNITKQN
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggtacatctattatcaaacacttattacttttattatatgccaaaaagacccaagacc
atgaatgattatttagcaggtcttcaatgtatatctggtccaattaaaactgttgaagat
ttttggagttattatagccatatgatcagaccagttgatgaattctcacaattaagtgat
atttatttttttaaagaaggtattaaaccaatttgggaagatgcagaaaatagagacggc
ggtaaatttgttgtaaaaacaagaaggaattacacatcaaaatggtgggaagatttgtta
ttagcatttattggagaacaagtagatgatgttgaaaatattaatggaatcgttatttca
tttagagcaaatgataataatttaattggtatttggaataaaaatagcgaagataatgaa
aaattattggtcagtttaaagcatttatttaaaatagataaattggattacaaaccacat
tttggtagaatcttaaaagaggaagtttttcaaaataataaaaatgaaaataatagtaat
agtggatcaatgggtagcagtggtttattaagtgacagcggaaatgtttcactcgatgct
ccatctccagatacttttgatttcatgaaaccttcttcacttaatagtatttcttcacca
acaaacacaccattccaaccttatcttccatttggacaaccatcatcatcttcatcatca
tcgtcatcatcacaaccatcacaaccacacagtttctttagttttaataatttggatttt
aacataacaaagcaaaattaa

DBGET integrated database retrieval system