KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_26301Help
Entry
DICPUDRAFT_26301  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     DICPUDRAFT_26301
Peptidases [BR:dpp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   DICPUDRAFT_26301
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1003 aa AA seqDB search
MKNEQMEQRKIIKDLWVQQSFQFGETVNIISMIWLRQWKNYVKYDESPLINGNGNNSENG
HNEQQQNGKGVNHHHEFESPKPETIDNRELLEGIDSEGNPIMDRKLNEKTDFEIVPSKVW
SQLIQWYQGGPEIKRTVITLGFKDELYVEIKPYLINVKYHTSLISEIPSRNQNQQQQQTP
YLYSYQRSLKSTLAELRETIAKNENINPNHLEFYKNSTSGKSKPIKKITMSLEDLKFEDK
TDLILHYQTEQTQKGISKLGKKITGIFKKKGHGSGMGGRSYSDPSYYTNGVNGGGSSSSS
SSTSSNSNESSPTFENIDPKSSKEIVLSNKICGLSNLGNTCFMNSSLQCLAHTIPLTEYF
LSGKYACDINKTNPLGMKGQIAEIYGKLMKDMWTGSSNCVAPKHLKWIIGKYAPQFSGMS
QQDSQEFLSFLLDGLHEDLNKVLKKPYTEEKEESKEQREDAVVAAEHWENHIKRNQSIIV
NLFQGQYKSTLTCSKCSKVSITFDPYMYVTLPIPVPTERLFDVILFRRKPIEQLGPDPNG
IYCLNNAMAPIKYCLKLPKREDVETLRVELSKITGIESSCIALAETLKNRIYTFLNDQKS
LLSIKDKEVTIAYELPHAGEDISRIHVMHRSNGDLALLPYVLLLKYSETSRKDLYKMVWE
RVGHRVKKGWRSALRQKLKEQQNLNLENNSNNSSTTTVNDQDQDNISNQQEQHQQHQQQQ
QQFGEKDSHHSTFDDSQFEEDDASSVTDDDLFESIYPFVLKTTNGNGNHCDRCPNGCTGC
AVECDDKPLTILYKTPKYWREGCNNIAIDWRPEIIKYVDFIDHDDPTSPFTIQDKSIQLK
SEFRNDITLYDCLSIFTKNEELKKNDTWYCPDCKAHIEATKKLELWSAPKILVIHLKRFQ
YTSYTHRHEKINYYVDFPLDNLDISKLVLNKSYPPPVYQLYAISNHMGVMGSGHYTSCVK
NKDQWYLISDSSYRPIDKLKIKSSDAYVLFYQLKSPPTGTLQQ
NT seq 3012 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgaacaaatggaacaaagaaaaatcataaaggacttatgggtgcagcaatca
tttcagtttggtgaaacagtaaatataatatcaatgatatggttaagacaatggaagaat
tatgttaaatatgacgaatccccattaataaatggaaatggcaataacagtgaaaatgga
cataatgagcaacaacaaaatggaaagggtgtaaatcatcatcacgaatttgaatcacca
aagccagaaactattgataacagagaattacttgaaggtattgattcagaagggaatcca
ataatggatagaaagttaaacgaaaaaacagatttcgagattgtaccaagcaaagtatgg
agtcagcttattcagtggtatcaaggaggtccagaaattaaaagaactgttataacttta
ggttttaaagatgaactatatgtcgaaatcaaaccatatttaataaatgtaaaatatcac
acatcactaataagtgaaataccttcaaggaatcaaaaccaacagcaacaacaaacacca
tatttatattcataccaaagaagtttaaaatcaactctagcagagttaagagaaactatc
gcaaaaaatgaaaatatcaatccaaatcatttagaattttataaaaactccaccagtgga
aaatcaaaaccaataaagaaaataacgatgtctctagaagatctaaagtttgaggataaa
accgatttaatactacactatcaaactgaacaaactcaaaaaggtatttcaaagcttggt
aaaaagattacaggtatttttaagaagaaaggacatggcagtggaatgggtggaagatct
tactctgatccatcatactatactaatggcgtgaatggtggcggaagcagcagcagcagt
agttctacaagttcaaattctaacgaaagttcacccacttttgaaaatattgatccaaaa
agttcaaaagagattgtactttcaaataaaatttgtggtttgtcaaatcttggtaatact
tgctttatgaactcttcactacagtgtttagcacatactatacctttaacagaatacttt
ttatcaggaaaatatgcttgtgatattaataaaacaaacccattaggtatgaaaggtcaa
attgcagagatttatggaaaattaatgaaggatatgtggacaggtagcagtaattgtgta
gcaccaaaacatttgaaatggattattggtaaatatgcacctcaattcagtggtatgtca
cagcaagattcacaagaattcctatcattcttattggatggtcttcatgaagatttgaac
aaggtattaaagaaaccatacactgaagagaaagaagaatcaaaagagcaaagagaagat
gcagtagtagcagctgaacactgggaaaaccacatcaaaagaaatcaatcaatcattgta
aatttattccaaggtcaatataagagtacattaacctgctctaaatgtagcaaagttagt
atcacctttgatccctatatgtatgttactttacctataccagttccaactgaacgtcta
ttcgatgtcattctatttagacgtaaaccaattgaacaactaggaccggatccaaacgga
atctattgtttaaacaatgcaatggcaccaattaaatactgcttaaagttaccaaaaaga
gaagatgtcgaaaccttaagagttgaactttcaaagattaccggtatcgaatcatcatgt
attgcattagcagagacattaaaaaatagaatatatacttttcttaatgatcaaaagagt
ttactttcaattaaagataaagaagttacaattgcatacgaactaccacatgctggcgag
gatatttctagaatccatgttatgcatagaagtaatggtgatttagctcttttaccatat
gtattattattaaaatactctgaaacctcgcgtaaagatttatataaaatggtttgggaa
cgtgttggtcacagagttaaaaaggggtggcgttcagcattaagacaaaaattaaaggaa
caacaaaatttaaatttagaaaataatagcaacaactcctctacaacaactgtaaatgat
caagatcaagataatattagcaatcaacaagagcaacatcaacaacatcaacaacaacaa
caacaattcggtgaaaaagatagtcatcatagcacctttgatgatagccagtttgaagaa
gatgatgcctcatcagttacagatgatgatttattcgaatcaatctatccattcgtttta
aaaaccaccaatggtaatggtaatcattgtgatcgttgcccaaatggttgtactggttgt
gcagtcgaatgcgatgataaaccattaacaattttatataaaactccaaaatactggcgt
gaaggttgtaataatatagctattgattggagaccagagattatcaaatatgtcgatttt
attgaccatgacgatccaacatcaccattcacaattcaagataaaagcattcaattaaaa
tcagaatttagaaatgacataaccctctacgattgtctatcaatcttcacaaagaacgaa
gaactcaagaagaatgatacatggtattgtccagattgtaaagctcatattgaagcaact
aaaaaattagaattatggagcgctccaaaaattttggttattcatctcaaaagattccaa
tacacctcatacactcatcgtcatgaaaaaatcaactattatgtagacttcccactcgat
aatttagatatctccaaattagtattaaacaaatcttatccaccaccagtttatcaacta
tatgccatatcgaatcatatgggtgtaatgggttctggtcattatacttcttgtgttaaa
aataaagatcaatggtatttaattagtgactcttcatatcgtccaatagataaattaaaa
attaaaagttcagatgcctatgtattattttatcaactaaaatctccaccaactggaaca
ttacaacaataa

DBGET integrated database retrieval system