KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_26398Help
Entry
DICPUDRAFT_26398  CDS       T02090                                 

Definition
histone acetyl transferase
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Enzymes [BR:dpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     DICPUDRAFT_26398
Transcription machinery [BR:dpp03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     DICPUDRAFT_26398
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 359 aa AA seqDB search
MPTVTPVATTETLGPENIDVGKITAKEEKERGILRFEVITNDSTSKNLELLINLKNVFSK
QLPKMPREYIVRLMFDRFHESLLIIKNNNVIGGICFRPFRDQGFIEIAFCAITSSEQVKG
YGSFLMTHLKEYNRKTGIYHFLTFADNFAIEYFQKQGFTHEITLAKEKWKGFIQEYDGGS
LMECVVHPNVTYLDIPSMVRRQRDVLNAKIREISTSHLVNPGLKFFKNGERRIAIESIRG
IKESGWINNVDEAQIQNLQIQLGKALVEIKNHEDSWPFQKAVSLDEAPNYYNVVKDPVDL
QMISDRLAANNYYITKNIFLADLKRMCNNCREFNGEGTVYFEVADRLEKFCKNLINNIK
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgccaacagtaacaccagttgcaacaacagagacattagggccagagaatatagatgtt
ggtaaaattacagcaaaagaagaaaaagaaagaggtatattaagatttgaagttattaca
aacgatagtacatcaaagaatttagaactattaataaatttaaaaaatgtattttcgaaa
caattaccaaagatgcctagagagtatatagtcagattgatgtttgatagattccatgaa
tcgctacttatcataaagaataataatgttattggtggtatttgtttcaggcctttcaga
gatcaagggtttatagaaattgcattttgtgctattacatcaagcgagcaagttaaaggt
tatggttcatttttaatgactcatttaaaagaatataatagaaagactggtatttatcac
tttttaacttttgctgataattttgccatcgaatactttcaaaagcaaggttttactcac
gaaattactttggccaaagagaaatggaagggttttattcaagaatacgatggtggttcg
ttaatggagtgtgtagttcatccaaatgtaacatatttagatataccatcaatggtgcgt
agacaaagagatgttttaaatgctaaaattagagagattagtacctcccatttggttaat
cctggtttaaaattcttcaaaaatggtgaacgccgtatagccatcgaaagcattagaggc
atcaaagaatcaggttggattaacaatgtggacgaagctcaaattcaaaatcttcaaatt
caattaggaaaagctcttgtagaaattaaaaatcacgaagattcatggccatttcaaaaa
gcagtctcattagacgaagctccaaactattacaacgtagttaaagatcccgttgattta
caaatgatctctgatcgtttagcagcaaataattattatattacaaagaatatatttttg
gccgatttaaaaagaatgtgcaacaactgtagagaatttaatggtgaaggtacagtatat
tttgaagttgctgatcgtttagaaaaattttgtaaaaatttaataaataatataaaataa

DBGET integrated database retrieval system