KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_27445Help
Entry
DICPUDRAFT_27445  CDS       T02090                                 

Definition
ubiquitin carboxyl-terminal hydrolase isozyme L5
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 333 aa AA seqDB search
MGDNEGWCTIESDPGVFTELIDKIGVKDIQVEEIYSLDSSEYDRLKPVLGLIFLFKWEKD
DDNRQISDNQDLFFANQVIQNACATQAILSVLLNAEGIELGEELSNFKQFVGDFPPMMKG
EAIGNSDLIKTTHNSFTVQDPFIFSKSKSKKPQDAFHFISFIPFQGKVYELDGLKEGPYC
LGDCTPENWLEVATPFIQKRIEKYSQGEIRFNLMAVIKNRQTTLKEKISELEKKKEIIEK
KLSTIELPNSKDELDQLLMDINENIQDYNNDILMEQEKFRNWKDENIRRKHNFTPFILNL
VKALAEKEQLQPLIQKTKDQINQRQQQQQQQKK
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgggtgataatgaaggatggtgtacaatagaaagtgacccaggagtttttacagagctt
attgataaaattggtgttaaagatattcaagttgaagaaatatattccttagattcatcc
gaatatgatagattaaaaccagtattaggtttaattttcttattcaaatgggaaaaagat
gatgataatagacaaatttcagataatcaagatttattttttgccaatcaagtaattcaa
aatgcatgtgctactcaagctattttatcagttttattaaatgccgaaggtattgaactt
ggtgaagagttatcaaactttaagcaatttgttggagatttcccaccaatgatgaaaggt
gaagccattggtaatagtgatttaattaaaacaacacataatagttttacagtacaagat
ccatttatattttcaaaatctaaaagcaaaaaaccacaagatgcatttcatttcatttca
tttataccatttcaaggaaaagtttatgaattggatggcttaaaagaaggtccatattgt
ttaggcgactgcacaccagagaattggttagaggttgcaacaccatttattcaaaagaga
atagaaaagtatagtcaaggtgaaattagattcaatttaatggcagttataaaaaataga
caaactacattaaaggaaaagatttcagaattggaaaagaaaaaagagattattgaaaaa
aaactatcaaccattgaattaccaaactcaaaagatgagttagatcaattattaatggat
attaatgaaaacattcaagactataacaatgatattttaatggaacaagagaaatttaga
aattggaaagatgaaaatataagaagaaaacataactttaccccattcattttaaatctt
gttaaagctttagctgaaaaagaacaattacaacctttaattcaaaaaacaaaagatcaa
ataaatcaaagacaacaacaacaacaacaacaaaaaaaataa

DBGET integrated database retrieval system