KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_30555Help
Entry
DICPUDRAFT_30555  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DICPUDRAFT_30555
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DICPUDRAFT_30555
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    DICPUDRAFT_30555
Enzymes [BR:dpp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     DICPUDRAFT_30555
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 455 aa AA seqDB search
MYFPKKNILKYSGNINVIKFLNNININYTNINHNNNNNHNNSYYNKNLYMTTINNYNNLN
VNRNKYFCTKINNNNNYNNGFFKNYNINSKNLKLNERKELIESFIVDLEGGLIRDKVYRD
IGIVGNSNKQEVSSDILESLIKIRDDLERYILENSKTTSTTKSSVLNSGIIELDMVLGDL
IKDNLKNNGILYCKPLDTNSMEENVWRSIIENEAVHPYHNLSDPTNEIKNRTTRNRTCLV
LFHPRLPNLPLMSLYIAFTNGIPDNIPAIELNDPNAKENDINNIDSAIFYSISSLHKGLG
GVNLGHILITKAVEYIKLNNPKILHFCTLSPLPRFKKYLSKNHQKIVEKIQNEDLINDFK
NDLEYLALNYIYKEKSKPKRAYDPVCNFHLKNGASIYRLNWKADTSKKRLDESYGIMINY
YYDINNLQENSTRYTNDGFITTCPIFNIQFKNSKF
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtatttccctaaaaagaatatattaaaatattcaggaaatattaatgttattaaattt
ttaaataacattaatattaactacaccaatataaaccacaataacaataataaccataat
aatagttattataataaaaatttatatatgacaactattaataactataataacttaaat
gtcaatagaaataaatatttttgtactaaaataaataataataataattataataatggt
ttttttaaaaattataatataaatagtaaaaatttaaaactaaacgaaagaaaggaatta
atcgaatcatttattgttgatttagagggtggattaataagagataaagtatatagggat
atcggaatagtgggtaatagtaataaacaagaagtttcaagtgacattctagaatcatta
attaaaatcagagatgatttagaaagatatatattagaaaactccaagaccacaagtaca
accaaatcctcagtattaaattcaggtataatagagttggacatggtgttaggcgattta
attaaagataatttaaaaaacaatggtatactttattgcaaaccattggacaccaatagt
atggaggaaaacgtttggagatcaattatagagaacgaagcagttcatccatatcataat
ttaagtgacccaactaatgaaattaaaaatagaactactcgtaatagaacatgcttggta
ttgttccacccaagactaccaaatctaccactcatgtcattatatatcgcatttaccaat
ggtataccagacaacattccagcaatcgaacttaacgacccaaatgcaaaagaaaatgat
ataaataacatcgactcggcaatattctattcaatatcctctcttcataaaggtctaggt
ggtgttaatttaggacatatattaattacaaaagctgtagaatacatcaaattaaataat
cctaaaattttacacttttgcacactttcaccattaccaagatttaaaaaatatttatca
aaaaatcatcaaaaaatagtcgaaaaaattcaaaacgaagatttaattaatgattttaaa
aatgatttggaatatttggctttaaactatatttataaagaaaaaagtaaaccaaaaaga
gcatatgacccagtatgcaatttccatttaaaaaatggtgccagtatttatagattaaat
tggaaagcagatacctcaaaaaaaagactcgatgaaagttatggaataatgattaactac
tattacgatattaataatttacaagagaactcaactcgatatacaaatgatggcttcata
acaacctgcccaatatttaatattcaatttaaaaacagtaaattttaa

DBGET integrated database retrieval system