KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_30555Help
Entry
DICPUDRAFT_30555  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:dpp00640]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:dpp00410]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:dpp04146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 455 aa AA seqDB search
MYFPKKNILKYSGNINVIKFLNNININYTNINHNNNNNHNNSYYNKNLYMTTINNYNNLN
VNRNKYFCTKINNNNNYNNGFFKNYNINSKNLKLNERKELIESFIVDLEGGLIRDKVYRD
IGIVGNSNKQEVSSDILESLIKIRDDLERYILENSKTTSTTKSSVLNSGIIELDMVLGDL
IKDNLKNNGILYCKPLDTNSMEENVWRSIIENEAVHPYHNLSDPTNEIKNRTTRNRTCLV
LFHPRLPNLPLMSLYIAFTNGIPDNIPAIELNDPNAKENDINNIDSAIFYSISSLHKGLG
GVNLGHILITKAVEYIKLNNPKILHFCTLSPLPRFKKYLSKNHQKIVEKIQNEDLINDFK
NDLEYLALNYIYKEKSKPKRAYDPVCNFHLKNGASIYRLNWKADTSKKRLDESYGIMINY
YYDINNLQENSTRYTNDGFITTCPIFNIQFKNSKF
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgtatttccctaaaaagaatatattaaaatattcaggaaatattaatgttattaaattt
ttaaataacattaatattaactacaccaatataaaccacaataacaataataaccataat
aatagttattataataaaaatttatatatgacaactattaataactataataacttaaat
gtcaatagaaataaatatttttgtactaaaataaataataataataattataataatggt
ttttttaaaaattataatataaatagtaaaaatttaaaactaaacgaaagaaaggaatta
atcgaatcatttattgttgatttagagggtggattaataagagataaagtatatagggat
atcggaatagtgggtaatagtaataaacaagaagtttcaagtgacattctagaatcatta
attaaaatcagagatgatttagaaagatatatattagaaaactccaagaccacaagtaca
accaaatcctcagtattaaattcaggtataatagagttggacatggtgttaggcgattta
attaaagataatttaaaaaacaatggtatactttattgcaaaccattggacaccaatagt
atggaggaaaacgtttggagatcaattatagagaacgaagcagttcatccatatcataat
ttaagtgacccaactaatgaaattaaaaatagaactactcgtaatagaacatgcttggta
ttgttccacccaagactaccaaatctaccactcatgtcattatatatcgcatttaccaat
ggtataccagacaacattccagcaatcgaacttaacgacccaaatgcaaaagaaaatgat
ataaataacatcgactcggcaatattctattcaatatcctctcttcataaaggtctaggt
ggtgttaatttaggacatatattaattacaaaagctgtagaatacatcaaattaaataat
cctaaaattttacacttttgcacactttcaccattaccaagatttaaaaaatatttatca
aaaaatcatcaaaaaatagtcgaaaaaattcaaaacgaagatttaattaatgattttaaa
aatgatttggaatatttggctttaaactatatttataaagaaaaaagtaaaccaaaaaga
gcatatgacccagtatgcaatttccatttaaaaaatggtgccagtatttatagattaaat
tggaaagcagatacctcaaaaaaaagactcgatgaaagttatggaataatgattaactac
tattacgatattaataatttacaagagaactcaactcgatatacaaatgatggcttcata
acaacctgcccaatatttaatattcaatttaaaaacagtaaattttaa

DBGET integrated database retrieval system