KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_31198Help
Entry
DICPUDRAFT_31198  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    DICPUDRAFT_31198
  Replication and repair
   03420 Nucleotide excision repair
    DICPUDRAFT_31198
Transcription machinery [BR:dpp03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     DICPUDRAFT_31198
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 471 aa AA seqDB search
MKVFQYLTTLDARDLEDLYKDSWTCQAIVRSLPPRAKQYIFKMLMVDTYPLTIAKDWSQH
SSNHQHKEALKKLFDLKIILLNRGKQQSEQSIQLNPLFQENIKSALVEFDKVIFSNSSNI
KDTNKIPNINDLDNYSKKQWEQVLYFLSDDAAQPSKFISDLLLSSNLTRRDQDGSLSITS
DGFKFLLKDVYTQIWTLLIVYLNDLEKKRREGLTQGSRNDLLGFLFRLSFLQLGKGYLVG
ELTELQKEYLICLKQFGLIYMKSDASLFFYPTRLIISLTTGKTLSLIQTLAVDKINSSSN
SANTVASSTIEKKESGYIVLETNYRLYAYTASSLQISLLSLFVKMLYRLPNLAVGIITRE
SIRTALIHGITADQIIDFIRHNAHPNAVNNGQPIPDVVAEQILLWEQERNRITYTKSVLY
NSFPTTDCYHATLKFAKEQDYYIWSNDQLKTLVVNENGNDPIRNFIKKNFA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtttttcaatatttaacaacattagatgcaagagatttagaggatttatataaa
gattcatggacatgtcaagccatcgttagatcattacctccaagagcgaaacaatatata
ttcaaaatgttaatggtagatacatatccattgacaattgccaaagattggtcacagcat
tcatcaaaccatcaacataaagaggcattaaaaaagctatttgatttaaaaattatatta
ttaaacagaggtaaacaacagtcagagcaatctattcaattaaatccattgtttcaagaa
aatataaaaagtgcattagtagaatttgataaagttatattttcaaatagtagtaatatt
aaagatactaataaaataccaaatataaatgatttagataactattcaaagaagcagtgg
gaacaagttttatattttctatcggatgatgcagctcaaccatcaaaattcatttcagat
ttactattatcgagtaatttaactagaagagatcaagatgggtcattatcgatcacaagt
gatggtttcaagtttttattaaaagatgtatatacacaaatttggacattgttgattgtg
tatctcaacgatttggaaaagaaaagacgagagggtttaacacagggctcaagaaacgat
ttgttgggttttctttttagactttcttttttacaattgggcaaaggttatttggttggc
gagcttacagaactacaaaaagaatatttaatatgtctcaagcaatttggtttgatatat
atgaagtctgatgcaagtttatttttttatccaacacgtttaattatatcattgaccacc
ggtaaaacactatcattgatccaaacattagcagtagataaaataaatagctcatccaac
agcgccaatactgtcgcaagcagcactatcgaaaagaaggaatcaggctatatagtttta
gaaaccaattacagattatatgcatatacagcatcatcattacaaatatcgttattatcg
ttgtttgtaaagatgctttatagactacccaatttagcagtaggcattatcactcgtgag
agtattagaaccgctctaattcatggtattaccgccgatcaaattatagatttcattaga
cacaatgcccatcccaatgcagtaaacaatggtcaacccattcccgatgtggtagcagag
caaatattactatgggaacaagagcgtaatcgtattacctacaccaaatcagttttatat
aattcttttccaacaaccgattgttatcatgcaactttgaaatttgcaaaagaacaagat
tattacatttggtccaatgaccaactaaaaactttggtagttaatgaaaatggtaatgat
ccaataagaaattttattaaaaagaattttgcataa

DBGET integrated database retrieval system