KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_32417Help
Entry
DICPUDRAFT_32417  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICPUDRAFT_32417
Enzymes [BR:dpp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     DICPUDRAFT_32417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 320 aa AA seqDB search
MATASSLSIEQLQKLWNTKYLSVVAGVNNLPKFVLKTSTSSCEIYLHGAHVTSFKINSNE
NLFMSEKSAFQENKAIRGGIPLIWPQFGPGKIQTHGFARNLDWDVNKALVDEKAQSVQIE
FFLKSSEATDKILGVSSEFIVFYRVTLHPDFLDLEYEVKNTSQQNTMEFQLAFHTYYSIS
DIKNVHVLGLKGREYIDKMKNMEKKKENRKEVTIDQEVDSVYLNVIPTQGGSSYQPLQLV
DTQKKTSVTLTYDYQSIPDVVVWNPWIEKSKKMEDFGDEEYHKMICIEIGVINNPVKLSP
NQTFQTKHSILPTNSSSSSL
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atggccactgcatcatctttaagtattgagcaacttcaaaaactatggaacaccaaatat
ctaagtgtagttgcaggtgtaaataatttaccaaagtttgtattaaaaacatcaacatca
tcttgtgaaatttatttacatggtgcacatgtaacatcatttaaaatcaattcaaatgaa
aatttatttatgagtgaaaagtcagcatttcaagaaaataaagcaatcagaggtggtata
ccattgatttggccccaatttggaccaggtaaaattcaaacacatggttttgctagaaat
ttggattgggatgtaaataaagcattggtcgatgaaaaggcacaatctgttcagattgaa
ttctttttaaagagcagcgaagcaactgataagatattgggcgttagtagcgagtttata
gtgttctatagagttactttacacccagatttcttagatttagaatatgaagttaaaaac
acaagtcaacaaaacacaatggagttccaattggcttttcatacctattattccatctct
gacatcaagaatgtacatgttctcggtttaaagggcagagagtacattgataaaatgaaa
aatatggagaaaaagaaagagaatcgtaaggaggtcactatagatcaagaagtcgatagc
gtttatttaaatgttataccaactcaaggtggttcaagttaccaaccattacaattggtt
gatacacaaaagaaaacatcagtcactcttacttatgattatcaatccattccagatgtt
gtagtttggaatccatggatcgaaaaatcaaagaaaatggaggatttcggcgatgaagaa
tatcataaaatgatttgtatagaaattggtgtaattaataaccctgtaaagttatcacct
aatcaaactttccaaaccaaacactcaattctaccaacaaattcttcttcttcatcttta
taa

DBGET integrated database retrieval system