KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_33863Help
Entry
DICPUDRAFT_33863  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K05605  3-hydroxyisobutyryl-CoA hydrolase [EC:3.1.2.4]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00280  Valine, leucine and isoleucine degradation
dpp00410  beta-Alanine metabolism
dpp00640  Propanoate metabolism
dpp01100  Metabolic pathways
dpp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    DICPUDRAFT_33863
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DICPUDRAFT_33863
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DICPUDRAFT_33863
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.4  3-hydroxyisobutyryl-CoA hydrolase
     DICPUDRAFT_33863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_2 ECH_1 FliG_N
Motif
Other DBs
NCBI-GeneID: 10501763
NCBI-ProteinID: XP_003288345
JGI: Dicpu1_33863
UniProt: F0ZLP9
Position
Unknown
AA seq 376 aa AA seqDB search
MFRAINLTSKNVRYFTTSTEEVLFDKKGKCLNVLLNRPKALNALNPGMVKLLTPKYQEMK
NMKDGDMVLIMKGSGEKAFCAGGDIKAIYDYKKGVAPSTENIGDLFFREEYILNNLIGTN
PIPQVSIYNGFAMGGGVGLSVHGKFRVATDTTVFAMPETAIGFFCDVGGSHFLPKLKHNY
GMYLALTGNKLKGKNVLASGVATHFISNERIKDVESALENLSNPTHENVKKVLDQVCDKI
DVNDSSLEFNQNLETIERIFGKSSVEEIFDSLEKENTEWSKQTLKTLKTVSPTSLKVVFE
QMNQGKKLPSLAKCLEMEFRISQHFLEKPDFFEGVRALLVDKDKNPKWNPSSIDQVSDDL
VKSYFAPLKSDQELKL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgttcagagcaattaaccttacatcaaaaaacgttagatactttacaacatcaacagaa
gaagttttgtttgataaaaaaggtaaatgtttaaatgttttattaaatagaccaaaagct
ttaaatgctttaaacccaggaatggttaagcttttaacaccaaaatatcaagaaatgaag
aatatgaaagatggtgacatggttttaattatgaaaggttctggtgaaaaagctttttgt
gctggtggtgatatcaaagccatttacgattataaaaaaggtgttgccccatcaactgaa
aacattggtgatcttttcttccgtgaagaatatattttaaataatttaattggtaccaat
ccaattccacaagtttcaatctataatggttttgcaatgggtggtggtgttggtttatca
gttcacggtaaatttagagttgctaccgatactactgtttttgctatgccagaaacagct
attggtttcttttgtgatgttggtggttcacactttttaccaaaattaaaacataactat
ggtatgtatttagctttaactggtaataaattgaagggtaaaaatgttttagcttcaggt
gttgcaactcattttatttcaaatgaaagaattaaagatgtagaaagcgcattagaaaat
ttaagtaatccaacacatgaaaatgttaaaaaagttttagatcaagtttgtgataaaatt
gatgttaacgactcatcattagaattcaatcaaaatttagaaactattgaaagaatcttt
ggtaaatcatcagtcgaagaaatctttgattcattggaaaaagaaaacactgaatggtca
aaacaaactcttaaaactcttaaaaccgtttcaccaacttcacttaaagttgtattcgaa
caaatgaatcaaggcaaaaaattaccatcattagccaaatgtctcgaaatggaattccgt
atctctcaacatttccttgaaaaaccagactttttcgaaggtgttcgtgctctcttagtt
gacaaagataagaatccaaaatggaacccatcctcaatcgaccaagtttcagacgattta
gttaaatcctattttgctccattaaaatctgatcaagaattaaaattataa

DBGET integrated database retrieval system