KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_34436Help
Entry
DICPUDRAFT_34436  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:dpp00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 529 aa AA seqDB search
MKPFIGAIDQGTSSTRFILFDKNGEIILSHQIILNQHHPHPGWVEHDGKEILDSVNKCID
VVMKQYYEKGYGTKEDIKAIGITNQRETTIVWDKTNSKPLHNAIVWCDTRTSDLVQYFTS
KAKKEHQQNNSNNENKCGLPISTYFSGLKLKWFFDNCENVRNSHSKGECLMGTIDSWLVW
NLTGGQSHVTDVTNASRTMLMNLETLKWDKSLCDFLEVPIEILPEIHSSSEVYGYVKEGP
LEGIPIAGVLGDQQAAMVGQMCFEKGQAKNTYGTGCFLLYNTGNDIVYSRNGLLTTVCYQ
FGPESKAVYALEGGVAVAGSGVRWLIDNMGIAKTSQEIEDLATSVKDTGGMYFVPAFSGL
FAPYWREDARGVMVGLTHHTNRCHMARAVLESTCLQTYEVLEAMQKDSGDTLLELRVDGG
MAKNNLLLQTQADLLSLPVVKPCNLETTCFGAAFAAGLAVGVWKESMEFKVGSKFTPQLD
QKNKMKKVNEWKKAVSKSLNWVDSIEDLNNDTEETISIQVSTSTDKLNE
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccatttataggagctattgatcaaggtacatcaagtacaagatttattttattt
gacaagaatggtgaaattatattatcacatcaaattattttaaatcaacatcatccacat
ccaggatgggtcgaacatgatggtaaagaaattttagattcagtcaataaatgtattgat
gttgtaatgaaacaatattatgaaaagggatatggtacaaaagaggatattaaagcaatt
ggtataacaaatcaaagagaaacaactatagtatgggacaaaacaaattcaaaaccatta
cataatgcaattgtttggtgcgatacacgtacatcagatttagtacaatattttacatca
aaagctaaaaaagaacatcaacaaaataatagtaataatgaaaacaaatgtggtttacca
attagcacttacttttcaggtttaaaattaaaatggttttttgacaattgcgaaaatgtt
agaaacagtcattctaaaggagaatgtttaatgggtacaattgatagttggttggtttgg
aatttaacaggtggtcaatctcatgttactgatgttaccaatgcaagtagaacaatgtta
atgaatttagaaacattaaaatgggataagagtttatgcgatttccttgaggttccaatc
gaaatattaccagaaattcatagttcatcagaagtttatggttatgttaaagaaggtcca
cttgaaggtattccaattgcaggtgttttaggtgatcaacaagctgctatggtgggtcaa
atgtgttttgaaaaaggacaagctaaaaacacctatggtacaggttgcttcttattgtat
aatactggtaatgatatcgtctactctagaaatggtcttttaacaactgtatgctatcaa
tttggaccagaatcaaaagcagtctatgcattggagggtggcgttgcagttgcaggttca
ggtgttagatggttaattgataatatgggtattgccaaaactagtcaagaaattgaggat
ttggctacatctgttaaagatacaggtggtatgtattttgtaccagcattctcaggtttg
ttcgcaccatattggagagaagatgcaagaggtgtaatggtaggattgactcatcacacc
aatcgttgtcacatggctagagccgtattagagtcgacatgtcttcaaacctatgaagtt
ttagaagcaatgcaaaaagattctggtgacacattattagagctccgtgtagatggtggc
atggcaaagaataaccttttacttcaaactcaagcagatctccttagtctcccagttgtt
aaaccatgtaatttagaaaccacctgctttggtgccgcttttgctgctgggttagccgtg
ggtgtttggaaagaatcaatggagtttaaagttggctctaaatttactcctcaactagat
caaaagaataaaatgaaaaaagtaaacgaatggaagaaagcagtttcaaaatctttaaat
tgggttgattcaatcgaagatttaaataatgatacagaagaaacaattagtattcaagta
tcaacttcaactgataaactaaacgaataa

DBGET integrated database retrieval system