KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_40649Help
Entry
DICPUDRAFT_40649  CDS       T02090                                 

Definition
hypothetical protein
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 282 aa AA seqDB search
CIKLLDWFKYRDHMCLVFRKYGLSLYDFLKKNKYRPLPLSQIQKIGRQLLTAIYSMHKLS
LVHTDLKPENILLEKTNYGIHQEKKVPIQLQMESLQFDLNQYYHLNQTDIVVIDFGGATF
ENKHHTTIVCSRPYRPPEIILGMGWSYPCDIWGVGCILVELYLGFTLFDTHNNRQHLAMM
EKVMGPFPHSMSNISKKYFESDGKLSKPQSEDELKSLERVENLKRLKDYFHPCHKSFFDL
SCKLLEYQPTKRISAKDALSHPFFDFSIQNDLFEPIIGIPEC
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
tgtataaaattattagattggttcaaatacagagaccacatgtgcttggtattcaggaaa
tatgggttaagtttgtatgattttttaaaaaaaaataaatataggccacttccactatca
caaattcaaaagatcggtagacaacttttaactgcaatatattcaatgcacaaattatca
ttagtacatacagatttgaaaccagagaatattttattggaaaagacaaactatggcata
catcaagaaaagaaagtaccaatccaattgcaaatggaatccttacaatttgatctaaat
caatactatcatttaaaccaaactgatatagtcgtaatagatttcggtggcgcaacattc
gagaacaaacaccataccactatagtttgtagtagaccttatagaccacctgaaattatt
cttggaatgggttggtcatatccatgcgatatttggggtgtcggttgcattttagtagag
ttatatttaggtttcactttgtttgatactcataataatagacaacacctggccatgatg
gaaaaggttatgggtccatttccacactctatgtcaaatatttcaaagaaatattttgaa
agtgatggtaaactttcaaagcctcaatcagaagatgaattaaaatcattagaaagagta
gagaatttaaaaagattaaaagattattttcatccatgtcacaaatcattttttgacctt
tcttgtaaacttttagagtatcaaccaaccaaaagaatttccgccaaagatgccctgtca
cacccattttttgactttagtattcaaaatgatttatttgaacctattataggtatacca
gaatgttaa

DBGET integrated database retrieval system