KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_41544Help
Entry
DICPUDRAFT_41544  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K03259  
translation initiation factor 4E
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    DICPUDRAFT_41544
Translation factors [BR:dpp03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    DICPUDRAFT_41544
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 254 aa AA seqDB search
MSSNNNEVECLVEPTSKISITEENKQENKETTTTTTTNTDNKEEQPQEEQPKEEQEQEEQ
QEEEQEQQTENPENLIKHPLQNRWSLWYDYQSGKINPEHWVDSLKKVISFDSVEDFWCVF
NNLPNVSNLKQGSSYHLFKDDIEPKWEHESNKRGGKWFVMVKDKSRCDNQWLQSVMACVG
ETFDSSDEICGIVYNSRKNGDKISVWTKNAHDEKATKDIGYCLKKILEVDNTISYTPHED
VMRTSKGAKNLYEC
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcaaataacaatgaagtagagtgcttagttgaacctacatctaaaatttcaatc
acagaagaaaataaacaagaaaataaagaaaccaccaccactaccaccaccaatacagat
aataaagaagaacaaccacaagaagaacaaccaaaagaagaacaagaacaagaagaacaa
caagaagaagaacaagaacaacaaacagaaaatccagaaaatttaattaaacatccactt
caaaatagatggtccttatggtatgattatcaaagtggtaaaatcaatccagaacattgg
gttgactcattaaaaaaggttattagtttcgattcagtcgaagatttttggtgtgttttc
aataaccttccaaatgttagcaatttaaaacaaggtagcagttatcatttatttaaagac
gatatcgaaccaaaatgggaacacgaatcaaataaaagaggtggcaaatggtttgttatg
gttaaagataaatcgcgttgtgataaccaatggcttcaatctgttatggcttgtgttggt
gaaacttttgactctagtgatgaaatttgtggtatagtttataattcaagaaagaatggt
gataaaatcagtgtttggacaaagaatgcccacgatgaaaaagcaactaaagatattggt
tactgtcttaaaaaaattttagaagtcgataatactatttcttatactccacatgaagat
gttatgagaacatcaaaaggtgccaaaaatttatatgaatgttaa

DBGET integrated database retrieval system