KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_41556Help
Entry
DICPUDRAFT_41556  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:dpp03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:dpp03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 221 aa AA seqDB search
MSLYNKSTQFKNWVFTNEQLKQSREECNNETKKKILEKTPTHEPNILSTEEELQLIHYYE
SKALEFSNALNLPEKVSATAIIYIKRFYLKNSVMAYNPKLIMFTCLFLACKTEDNHLDID
YYTGVIKTSAADIISLEVVILESLKFNLIIYHPFRSLYAFILDISDNTNLYNNSQPIKFD
TLWDTSKKLIQKTLFSDLSFYYHPAIIALACLSLNFENFNL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgtataataaatcaacacagtttaaaaattgggtttttacaaatgaacaatta
aagcaatcaagagaagaatgtaataatgaaactaaaaagaaaatattagaaaagacacct
acacatgaaccaaacatattatcaactgaagaagaactacaactaattcattactatgag
agcaaggctttagagtttagtaatgcgctaaacttaccagaaaaagtttcagcaacagca
attatttatattaaaagattttatttaaaaaatagtgttatggcatataaccccaaacta
ataatgtttacctgcttatttttagcatgcaaaacagaggataatcatttagatatcgac
tattatacaggtgtcatcaaaacatcagcagcagatattattagtttagaggttgttatt
ttagaatcattaaaatttaatcttattatttatcatccattcagatcactatatgcattc
atattagatatttcagacaacaccaatttatataataattctcaacctataaaatttgac
acactttgggatacctcaaaaaaacttattcaaaaaactttattcagcgacttatctttt
tattatcacccagcaattattgctttagcatgtttaagtttaaattttgaaaactttaat
ctgtaa

DBGET integrated database retrieval system