KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_41556Help
Entry
DICPUDRAFT_41556  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    DICPUDRAFT_41556
  Replication and repair
   03420 Nucleotide excision repair
    DICPUDRAFT_41556
Transcription machinery [BR:dpp03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     DICPUDRAFT_41556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 221 aa AA seqDB search
MSLYNKSTQFKNWVFTNEQLKQSREECNNETKKKILEKTPTHEPNILSTEEELQLIHYYE
SKALEFSNALNLPEKVSATAIIYIKRFYLKNSVMAYNPKLIMFTCLFLACKTEDNHLDID
YYTGVIKTSAADIISLEVVILESLKFNLIIYHPFRSLYAFILDISDNTNLYNNSQPIKFD
TLWDTSKKLIQKTLFSDLSFYYHPAIIALACLSLNFENFNL
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtcattgtataataaatcaacacagtttaaaaattgggtttttacaaatgaacaatta
aagcaatcaagagaagaatgtaataatgaaactaaaaagaaaatattagaaaagacacct
acacatgaaccaaacatattatcaactgaagaagaactacaactaattcattactatgag
agcaaggctttagagtttagtaatgcgctaaacttaccagaaaaagtttcagcaacagca
attatttatattaaaagattttatttaaaaaatagtgttatggcatataaccccaaacta
ataatgtttacctgcttatttttagcatgcaaaacagaggataatcatttagatatcgac
tattatacaggtgtcatcaaaacatcagcagcagatattattagtttagaggttgttatt
ttagaatcattaaaatttaatcttattatttatcatccattcagatcactatatgcattc
atattagatatttcagacaacaccaatttatataataattctcaacctataaaatttgac
acactttgggatacctcaaaaaaacttattcaaaaaactttattcagcgacttatctttt
tattatcacccagcaattattgctttagcatgtttaagtttaaattttgaaaactttaat
ctgtaa

DBGET integrated database retrieval system