KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_41734Help
Entry
DICPUDRAFT_41734  CDS       T02090                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dpp00230]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 201 aa AA seqDB search
MDVKAESLIPIIITGPSGVGKGTLIDRLRKEFDGSFGHIVSHTTRKPRDGEAHGVHYYFT
DIPTMTKEIENGDFIEHANVHGNFYGTSKRALQEVAEKGKICILDIDVQGCESVKKAAIP
CKYIFISPPTFETLEKRLIGRGTETEQSLKKRLETAKKEMEYRDMPGFFDHVIVNNVLDV
AYDELKQIILPYINYQKSISK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggatgttaaagcagaatcattaattccaattattattactggtccatctggtgttggt
aaaggaaccttaattgatagattaagaaaagagtttgatggatcatttggacatattgtt
tcacatactacacgtaaaccaagagatggtgaagcccacggtgttcattattattttaca
gatatcccaacaatgactaaagaaatcgaaaatggtgatttcatcgaacatgccaacgtt
catggtaacttttatggtacctcaaagagagcccttcaagaggttgctgaaaaaggtaaa
atttgtattttagatatcgatgttcaaggctgtgaatctgttaaaaaagctgctattcca
tgtaaatacatttttatttcaccaccaacttttgaaactttagaaaagagattaatcgga
agaggtacagaaactgaacaaagccttaaaaaaagattagaaacagctaaaaaagaaatg
gaatatagagatatgccaggatttttcgatcacgttattgttaataatgttttagatgtt
gcatatgacgaattaaaacaaatcattttaccatatatcaactatcaaaaatcaatttca
aaataa

DBGET integrated database retrieval system