KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_42309Help
Entry
DICPUDRAFT_42309  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DICPUDRAFT_42309
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     DICPUDRAFT_42309
Exosome [BR:dpp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DICPUDRAFT_42309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 523 aa AA seqDB search
MSHFLLEEDFTKKQRFTSVHKRIFYLLISLAIIATVVLLIAFLLPRGWEPPIKKTNIIMM
VGDGMGPASLTMARISFSKDFTEEKSLFLDPYLVGTVRTYSHSNDVTDSAAAATAYASGI
KTTNDVVGVDHLNKPAGTLFEAAKLKQMKTGVVVTTRISDATPACYFSHSVNRNYEYFII
NQLLEKDLDVVLGGGKMYFGDNFDKIQSYNYTFVNTTEQMNNVASGKIMGLFADYNIPWE
IDRLNDPILKKNVPSLSEMTKKALDLINQNNEHGFILMVEGSKIDVAAHINDAPTQIYET
REFDNTFELVREWAEKDGNTIVIVTADHETGGLTLAYQEEIDGHPMYSWSPETLLQVTKS
ADEMARIITTNATKDVNVTQVIHQYTGITIKPEEEEKILSFLQYRDTDSNRFRAINQQIG
RIVSNYAHVGFTTGGHSGVDVNLYTYGDKISPEKFEEREKKDELYTTDNYKDTMLMGNVN
NIEIASFISQALGLDLPNITKSLINFDPNGKAYEDEMIHKYSK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtcacattttttacttgaagaagattttacaaaaaaacaaagatttacctcagttcat
aaaagaatattttatttattaatatcattggcaattatagcaacagtagtattattaatt
gcatttttattaccaagaggatgggaaccaccaattaaaaaaacaaatattattatgatg
gttggtgatggtatgggaccagcatcattgacaatggcaagaatttcatttagcaaagat
ttcacagaagaaaaatcattatttttagatccatatttagttggtactgttagaacatat
tcacattcaaacgatgttacagatagtgctgctgctgctactgcctatgcaagtggtatt
aaaactacaaatgatgttgttggtgttgatcatttaaataagcctgctggtacacttttt
gaggctgcaaaattaaagcaaatgaaaactggtgtcgttgttacaactcgtatttctgat
gcaacaccagcttgctatttctctcattctgttaaccgtaattatgaatatttcatcatc
aaccaattgttggagaaggacttggacgttgttttaggtggtggaaaaatgtattttggt
gacaactttgataagattcaatcatacaactacacttttgtcaatacaacagaacaaatg
aacaatgtcgcaagtggcaaaattatgggtctatttgcagattacaacatcccatgggaa
atcgatcgtttaaatgatccaatcttaaagaaaaacgttccatcattatcagaaatgact
aaaaaagcacttgatcttatcaaccaaaacaacgagcacggttttattttaatggttgag
ggttccaaaattgatgttgctgctcatataaatgatgctccaacccaaatatacgaaacc
agagagtttgataatacattcgaactcgttagagaatgggcagagaaggatggcaatacc
attgttatcgttacagcagatcatgaaactggtggtcttacattagcatatcaagaagaa
attgatggtcatccaatgtacagttggtctccagaaacattacttcaagttaccaaatca
gccgatgaaatggcaagaataatcaccaccaatgcaaccaaagatgttaatgttacccaa
gttatccatcaatatacaggtatcaccatcaaaccagaagaagaagaaaagatattaagt
ttccttcaatatagagatacagatagtaatagatttagagctattaatcaacaaattggt
cgtattgtttcaaactatgctcatgttggtttcactaccggtggtcactctggtgttgat
gtcaacctttatacctatggcgataaaatttcaccagagaaatttgaagaacgtgaaaag
aaggatgaattatataccaccgataattataaagatacaatgttaatgggtaatgtcaac
aatattgaaatcgcatcattcatctctcaagctttaggtctagatttaccaaatattacc
aaatctttaattaattttgatccaaatggaaaagcatacgaagatgaaatgattcataaa
tattccaaataa

DBGET integrated database retrieval system