KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_42309Help
Entry
DICPUDRAFT_42309  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dpp00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 523 aa AA seqDB search
MSHFLLEEDFTKKQRFTSVHKRIFYLLISLAIIATVVLLIAFLLPRGWEPPIKKTNIIMM
VGDGMGPASLTMARISFSKDFTEEKSLFLDPYLVGTVRTYSHSNDVTDSAAAATAYASGI
KTTNDVVGVDHLNKPAGTLFEAAKLKQMKTGVVVTTRISDATPACYFSHSVNRNYEYFII
NQLLEKDLDVVLGGGKMYFGDNFDKIQSYNYTFVNTTEQMNNVASGKIMGLFADYNIPWE
IDRLNDPILKKNVPSLSEMTKKALDLINQNNEHGFILMVEGSKIDVAAHINDAPTQIYET
REFDNTFELVREWAEKDGNTIVIVTADHETGGLTLAYQEEIDGHPMYSWSPETLLQVTKS
ADEMARIITTNATKDVNVTQVIHQYTGITIKPEEEEKILSFLQYRDTDSNRFRAINQQIG
RIVSNYAHVGFTTGGHSGVDVNLYTYGDKISPEKFEEREKKDELYTTDNYKDTMLMGNVN
NIEIASFISQALGLDLPNITKSLINFDPNGKAYEDEMIHKYSK
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgtcacattttttacttgaagaagattttacaaaaaaacaaagatttacctcagttcat
aaaagaatattttatttattaatatcattggcaattatagcaacagtagtattattaatt
gcatttttattaccaagaggatgggaaccaccaattaaaaaaacaaatattattatgatg
gttggtgatggtatgggaccagcatcattgacaatggcaagaatttcatttagcaaagat
ttcacagaagaaaaatcattatttttagatccatatttagttggtactgttagaacatat
tcacattcaaacgatgttacagatagtgctgctgctgctactgcctatgcaagtggtatt
aaaactacaaatgatgttgttggtgttgatcatttaaataagcctgctggtacacttttt
gaggctgcaaaattaaagcaaatgaaaactggtgtcgttgttacaactcgtatttctgat
gcaacaccagcttgctatttctctcattctgttaaccgtaattatgaatatttcatcatc
aaccaattgttggagaaggacttggacgttgttttaggtggtggaaaaatgtattttggt
gacaactttgataagattcaatcatacaactacacttttgtcaatacaacagaacaaatg
aacaatgtcgcaagtggcaaaattatgggtctatttgcagattacaacatcccatgggaa
atcgatcgtttaaatgatccaatcttaaagaaaaacgttccatcattatcagaaatgact
aaaaaagcacttgatcttatcaaccaaaacaacgagcacggttttattttaatggttgag
ggttccaaaattgatgttgctgctcatataaatgatgctccaacccaaatatacgaaacc
agagagtttgataatacattcgaactcgttagagaatgggcagagaaggatggcaatacc
attgttatcgttacagcagatcatgaaactggtggtcttacattagcatatcaagaagaa
attgatggtcatccaatgtacagttggtctccagaaacattacttcaagttaccaaatca
gccgatgaaatggcaagaataatcaccaccaatgcaaccaaagatgttaatgttacccaa
gttatccatcaatatacaggtatcaccatcaaaccagaagaagaagaaaagatattaagt
ttccttcaatatagagatacagatagtaatagatttagagctattaatcaacaaattggt
cgtattgtttcaaactatgctcatgttggtttcactaccggtggtcactctggtgttgat
gtcaacctttatacctatggcgataaaatttcaccagagaaatttgaagaacgtgaaaag
aaggatgaattatataccaccgataattataaagatacaatgttaatgggtaatgtcaac
aatattgaaatcgcatcattcatctctcaagctttaggtctagatttaccaaatattacc
aaatctttaattaattttgatccaaatggaaaagcatacgaagatgaaatgattcataaa
tattccaaataa

DBGET integrated database retrieval system