KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_42383Help
Entry
DICPUDRAFT_42383  CDS       T02090                                 

Gene name
PKAC
Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Enzymes [BR:dpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     DICPUDRAFT_42383 (PKAC)
Protein kinases [BR:dpp01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   DICPUDRAFT_42383 (PKAC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 565 aa AA seqDB search
MGHNNNSNNSNNNRSNRNQTAWISPLSSPPQGNVYTNIPNSTTYTFGSNNSNPNNSNNNN
SNNKHSPLTSATDRLTKMDIEEKWDNKTYEKDEREKSPVFHISTSNFNSFGNLKVPGSFS
LFNKDENNKPHLPTIPQDQPLKEQPEQTTSNNKPHVSLLHAHSTYQPSNVKEHITSPIYE
QHQLSTKEIEHQKKLQEQHTSSATTSTTTSSATSPTKSQQSLQQAQQQQAQQPRVNTFFL
PPPQNARERLKEFKQIRVIGTGTFGKVYLIQNTKDGSFYAMKCLSKAYVVQLKQVEHLNS
EKSILSSIHHPFIVNLYQAFQDEKKLYLLFEYVAGGEVFTHLRKSMKFSNSTAKFYAAEI
VLALEFLHKQNIVYRDLKPENLLIDNEGHIKITDFGFAKRVEDRTFTLCGTPEYLAPEII
QSRGHGKAVDWWALGILIFEMLAGYPPFYDDDTFAIYNKILAGRITFPLGFDVDAKDLIK
RLLTADRTRRLGALRDGAQDVKNHRWFSDINWERLYQRKDPGPFIPSIKHEGDSSNFELY
EEENMVDDPPSPNYVDPYANFFKDF
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgggccataataataattctaataattcaaataataataggagtaataggaatcagacc
gcttggatttctcccttaagttctccccctcaaggaaacgtatatacaaatattccaaac
agtacaacatatacctttggatcaaataattccaaccccaataatagtaataataataat
agcaataataaacatagtccattaacttccgctaccgaccggttaactaaaatggatata
gaagagaaatgggataataaaacatatgaaaaggatgagcgtgaaaaatcaccagtgttt
catatatcaacaagcaattttaatagttttggtaatcttaaagttccaggtagttttagc
ttattcaataaagatgaaaataataaaccacatttaccaactatacctcaagaccaacca
ttaaaagaacaaccagagcaaacaaccagcaacaataaaccccatgtatctttattacat
gctcactcaacctaccaaccttcaaatgttaaggagcatataacctccccaatctatgaa
caacaccaattatcaactaaagaaattgaacatcaaaagaaattacaagagcaacataca
agctcagcaacaacaagcacaacaacaagctcagcaacaagcccaacaaaatcacaacaa
tctctacaacaagcccaacagcaacaagctcaacaaccaagagttaatacattcttctta
ccaccaccacaaaacgcaagagaaagattaaaagagtttaaacaaattcgtgttattggt
acaggtacttttggtaaagtttatttaattcaaaatactaaagatggaagtttttatgcc
atgaaatgtctaagtaaggcctatgtggttcaattaaaacaagtcgagcatttaaattca
gaaaagtctattctctcatctatccatcacccttttattgtaaatttatatcaagctttt
caagatgagaaaaaactatatcttttatttgaatatgttgctggtggtgaagtttttact
catttaagaaagtctatgaaattctcaaattcaacagccaaattttatgctgccgagatt
gtgttggctttagagtttctccataaacagaatatagtatacagagatttaaaaccagag
aatcttttaatcgataatgaaggtcatattaaaataacagattttggttttgccaaacgt
gtcgaagatagaacctttactctttgtggtactccagagtatttagccccagaaattatt
caaagcagaggtcatggtaaagctgttgattggtgggctttgggtattttaatttttgaa
atgttggctggttacccaccattctatgatgacgatacctttgcaatttataataaaatt
ttggctggtagaataacttttccactaggtttcgatgttgatgctaaagacttaattaaa
agattattaactgccgacagaactcgtagattaggtgctcttagagacggtgctcaagat
gttaaaaatcatagatggttttcagatatcaactgggaaagattataccaaagaaaagat
ccaggtccatttatccccagcattaaacatgaaggagattcgagtaactttgaattgtat
gaagaggaaaatatggtcgatgatccaccttcaccaaactatgttgatccatatgccaat
ttctttaaagatttttaa

DBGET integrated database retrieval system