KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_43840Help
Entry
DICPUDRAFT_43840  CDS       T02090                                 

Definition
hypothetical protein
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 480 aa AA seqDB search
MAILSVVVSLFTFYCFYSGYKKYKRVHESELKGPFPLPIIGNFHQISRLPHRDLTNMVKK
YGNIFRVYFGDIYTVVVSDPLLVREMFVKNADIFQDRLETPLTKHGSLYHGTTTSNGEYW
VRNRDIVSRAMKKTNIKHVYELLNEEIDRIVTVMKRMNSSGESFDPRYNLTKFTTCAMFK
YIFDEVLTDEKESHDKVKQIIDPMERLFKLMGGGNLFDSLDIGQPFYSLYLKYTEKDFDK
ILNFVKVRLNEHIETYNPDNTRDLLDVLIKEYGVDTEEDRFSIITTCGDFLFAGVETSAT
ALEYMLLMLTNRPEIQDKAYSEIKHHLGKRNKVLLSDRSSLIYTNAVIKETLRLKMVTAF
GLPRKCSEDCMIGEYFIPKNSQILVNFHALAMNKDYYSNPETFDPSRFLGDTNQAFIPFS
IGPRSCVGSQFAQDEIFICLSNILLNFRLKSIDGNKIDEEEVYGLTLKPKSPYKINLELR
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcgattttatctgttgtagtttctctttttacattttattgtttttatagtggttat
aaaaaatacaaaagggtccatgagagtgaactgaaaggtccatttcctttaccaatcatt
ggtaattttcatcaaatttcgagactaccacacagagatttaacaaatatggttaaaaaa
tatggaaatatttttagagtctattttggtgatatttatactgttgttgtatctgatcct
ttgttggttagagagatgtttgtaaagaatgccgatatatttcaagacagattagaaaca
cctcttacaaaacatgggtcattataccacggaactaccacaagcaatggtgaatattgg
gtaagaaatagggatatagtttctagggcaatgaaaaaaacaaatataaagcatgtatat
gaattattgaatgaggaaattgaccgaatagttaccgttatgaaaagaatgaattcatct
ggtgagagttttgaccctagatataatttaacaaagtttaccacatgcgcaatgtttaaa
tatatttttgacgaagttttaacagatgaaaaagagagccatgacaaagtaaaacaaata
atagacccaatggaaaggttatttaaactaatgggaggaggaaatctttttgattctttg
gatataggacaaccattttattcactttatttaaaatataccgaaaaggactttgataaa
attttaaattttgttaaagttagattaaatgaacatatagaaacctataatccagacaat
acaagagatttgttggatgttttaattaaagaatatggtgttgataccgaagaggataga
ttttcaataataacaacatgcggagactttttatttgcaggggttgaaacttcagcaact
gcattagagtatatgctattaatgttaacaaatagaccagaaatacaagataaagcatat
agtgaaatcaaacatcatttgggcaaaagaaataaagttttactttcagatagaagttcc
ttaatctacaccaatgcagttattaaggaaacacttagattaaagatggttaccgcattt
gggctacccagaaaatgttcagaagactgtatgattggtgaatattttattccaaaaaac
tcccagatattggtaaattttcatgctttggcaatgaacaaagattattatagtaatcca
gagacatttgatccatcaagatttttaggagataccaaccaagcattcattccattttcg
ataggtccacgttcttgtgttgggagccagtttgcccaagatgaaatattcatttgttta
tcaaatatattattaaactttagattaaaatcaatagatggaaataaaattgatgaggaa
gaagtttatggattaacactaaaaccaaaatcaccatataaaattaatttggaattaagg
tag

DBGET integrated database retrieval system