KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_43840Help
Entry
DICPUDRAFT_43840  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K07418  
cytochrome P450, family 2, subfamily J [EC:1.14.14.1]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Arachidonic acid metabolism
Linoleic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    DICPUDRAFT_43840
   00591 Linoleic acid metabolism
    DICPUDRAFT_43840
Enzymes [BR:dpp01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     DICPUDRAFT_43840
Cytochrome P450 [BR:dpp00199]
 Cytochrome P450, animal type
  CYP2 family
   DICPUDRAFT_43840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 480 aa AA seqDB search
MAILSVVVSLFTFYCFYSGYKKYKRVHESELKGPFPLPIIGNFHQISRLPHRDLTNMVKK
YGNIFRVYFGDIYTVVVSDPLLVREMFVKNADIFQDRLETPLTKHGSLYHGTTTSNGEYW
VRNRDIVSRAMKKTNIKHVYELLNEEIDRIVTVMKRMNSSGESFDPRYNLTKFTTCAMFK
YIFDEVLTDEKESHDKVKQIIDPMERLFKLMGGGNLFDSLDIGQPFYSLYLKYTEKDFDK
ILNFVKVRLNEHIETYNPDNTRDLLDVLIKEYGVDTEEDRFSIITTCGDFLFAGVETSAT
ALEYMLLMLTNRPEIQDKAYSEIKHHLGKRNKVLLSDRSSLIYTNAVIKETLRLKMVTAF
GLPRKCSEDCMIGEYFIPKNSQILVNFHALAMNKDYYSNPETFDPSRFLGDTNQAFIPFS
IGPRSCVGSQFAQDEIFICLSNILLNFRLKSIDGNKIDEEEVYGLTLKPKSPYKINLELR
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcgattttatctgttgtagtttctctttttacattttattgtttttatagtggttat
aaaaaatacaaaagggtccatgagagtgaactgaaaggtccatttcctttaccaatcatt
ggtaattttcatcaaatttcgagactaccacacagagatttaacaaatatggttaaaaaa
tatggaaatatttttagagtctattttggtgatatttatactgttgttgtatctgatcct
ttgttggttagagagatgtttgtaaagaatgccgatatatttcaagacagattagaaaca
cctcttacaaaacatgggtcattataccacggaactaccacaagcaatggtgaatattgg
gtaagaaatagggatatagtttctagggcaatgaaaaaaacaaatataaagcatgtatat
gaattattgaatgaggaaattgaccgaatagttaccgttatgaaaagaatgaattcatct
ggtgagagttttgaccctagatataatttaacaaagtttaccacatgcgcaatgtttaaa
tatatttttgacgaagttttaacagatgaaaaagagagccatgacaaagtaaaacaaata
atagacccaatggaaaggttatttaaactaatgggaggaggaaatctttttgattctttg
gatataggacaaccattttattcactttatttaaaatataccgaaaaggactttgataaa
attttaaattttgttaaagttagattaaatgaacatatagaaacctataatccagacaat
acaagagatttgttggatgttttaattaaagaatatggtgttgataccgaagaggataga
ttttcaataataacaacatgcggagactttttatttgcaggggttgaaacttcagcaact
gcattagagtatatgctattaatgttaacaaatagaccagaaatacaagataaagcatat
agtgaaatcaaacatcatttgggcaaaagaaataaagttttactttcagatagaagttcc
ttaatctacaccaatgcagttattaaggaaacacttagattaaagatggttaccgcattt
gggctacccagaaaatgttcagaagactgtatgattggtgaatattttattccaaaaaac
tcccagatattggtaaattttcatgctttggcaatgaacaaagattattatagtaatcca
gagacatttgatccatcaagatttttaggagataccaaccaagcattcattccattttcg
ataggtccacgttcttgtgttgggagccagtttgcccaagatgaaatattcatttgttta
tcaaatatattattaaactttagattaaaatcaatagatggaaataaaattgatgaggaa
gaagtttatggattaacactaaaaccaaaatcaccatataaaattaatttggaattaagg
tag

DBGET integrated database retrieval system