KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_44767Help
Entry
DICPUDRAFT_44767  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DICPUDRAFT_44767
   01230 Biosynthesis of amino acids
    DICPUDRAFT_44767
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICPUDRAFT_44767
   00051 Fructose and mannose metabolism
    DICPUDRAFT_44767
   00562 Inositol phosphate metabolism
    DICPUDRAFT_44767
Enzymes [BR:dpp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DICPUDRAFT_44767
Exosome [BR:dpp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DICPUDRAFT_44767
  Exosomal proteins of bladder cancer cells
   DICPUDRAFT_44767
  Exosomal proteins of melanoma cells
   DICPUDRAFT_44767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 257 aa AA seqDB search
MTGTRTFFVGGNHKMNGSKSMLESLCTGLNEQVEKKDNVKVFIAPSYPYLDFVNNKLDLN
KIQTSAQNCYSEAKGAFTGEISANMVVDLGIPYVIIGHSERRNVFNESNQLITKKTKYAI
SLGLTVILCLGEHLADRQNNKTEKVLDSQLEDFKSFSADEWKKIVIAYEPVWAIGTGVVA
SPQQAQDTHVYIRKWIAENVSKDVANQTSIMYGGSVGASNCSDLSKQADIDGFLVGGASL
ITNDFVTIIKSATPKTF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcacaagaactttttttgttggtggtaatcataaaatgaatggttcaaaatca
atgttagaatcattatgtactggtttaaatgaacaagtcgaaaaaaaagataatgttaaa
gtttttattgcaccatcatatccatatttagactttgttaataataaattagatttaaat
aaaattcaaactagtgcacaaaattgttatagtgaagctaaaggtgcattcactggtgaa
attagtgccaatatggttgtagatcttggtattccatacgttattattggtcacagcgaa
agaagaaatgttttcaatgaatcaaaccaacttatcacaaaaaaaaccaaatatgccatc
tctttaggtctcactgttattctttgtcttggtgaacatttagctgatcgtcaaaataac
aagactgaaaaagttttagactctcaattagaagatttcaaatcattctctgctgatgaa
tggaagaaaatcgttattgcatacgaaccagtttgggctatcggtactggtgttgttgct
tctccacaacaagctcaagatacccatgtttacattcgtaaatggatcgctgaaaatgta
tccaaagatgttgccaatcaaaccagtatcatgtatggtggtagtgttggtgcttcaaat
tgctccgatttatcaaaacaagctgatatcgatggtttcttagttggtggtgcctcttta
attaccaatgattttgtcaccatcataaaatctgccacaccaaagactttctga

  All links  
No link information was found.   
DBGET integrated database retrieval system