KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_44767Help
Entry
DICPUDRAFT_44767  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00010  Glycolysis / Gluconeogenesis
dpp00051  Fructose and mannose metabolism
dpp00562  Inositol phosphate metabolism
dpp01100  Metabolic pathways
dpp01110  Biosynthesis of secondary metabolites
dpp01130  Biosynthesis of antibiotics
dpp01200  Carbon metabolism
dpp01230  Biosynthesis of amino acids
Module
dpp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dpp_M00002  Glycolysis, core module involving three-carbon compounds
dpp_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICPUDRAFT_44767
   00051 Fructose and mannose metabolism
    DICPUDRAFT_44767
   00562 Inositol phosphate metabolism
    DICPUDRAFT_44767
Enzymes [BR:dpp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     DICPUDRAFT_44767
Exosome [BR:dpp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   DICPUDRAFT_44767
  Exosomal proteins of bladder cancer cells
   DICPUDRAFT_44767
  Exosomal proteins of melanoma cells
   DICPUDRAFT_44767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 10509282
NCBI-ProteinID: XP_003283377
JGI: Dicpu1_44767
UniProt: F0Z7J2
Position
Unknown
AA seq 257 aa AA seqDB search
MTGTRTFFVGGNHKMNGSKSMLESLCTGLNEQVEKKDNVKVFIAPSYPYLDFVNNKLDLN
KIQTSAQNCYSEAKGAFTGEISANMVVDLGIPYVIIGHSERRNVFNESNQLITKKTKYAI
SLGLTVILCLGEHLADRQNNKTEKVLDSQLEDFKSFSADEWKKIVIAYEPVWAIGTGVVA
SPQQAQDTHVYIRKWIAENVSKDVANQTSIMYGGSVGASNCSDLSKQADIDGFLVGGASL
ITNDFVTIIKSATPKTF
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacaggcacaagaactttttttgttggtggtaatcataaaatgaatggttcaaaatca
atgttagaatcattatgtactggtttaaatgaacaagtcgaaaaaaaagataatgttaaa
gtttttattgcaccatcatatccatatttagactttgttaataataaattagatttaaat
aaaattcaaactagtgcacaaaattgttatagtgaagctaaaggtgcattcactggtgaa
attagtgccaatatggttgtagatcttggtattccatacgttattattggtcacagcgaa
agaagaaatgttttcaatgaatcaaaccaacttatcacaaaaaaaaccaaatatgccatc
tctttaggtctcactgttattctttgtcttggtgaacatttagctgatcgtcaaaataac
aagactgaaaaagttttagactctcaattagaagatttcaaatcattctctgctgatgaa
tggaagaaaatcgttattgcatacgaaccagtttgggctatcggtactggtgttgttgct
tctccacaacaagctcaagatacccatgtttacattcgtaaatggatcgctgaaaatgta
tccaaagatgttgccaatcaaaccagtatcatgtatggtggtagtgttggtgcttcaaat
tgctccgatttatcaaaacaagctgatatcgatggtttcttagttggtggtgcctcttta
attaccaatgattttgtcaccatcataaaatctgccacaccaaagactttctga

DBGET integrated database retrieval system