KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_45258Help
Entry
DICPUDRAFT_45258  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    DICPUDRAFT_45258
Exosome [BR:dpp04147]
 Exosomal proteins
  Proteins found in most exosomes
   DICPUDRAFT_45258
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1699 aa AA seqDB search
MNSSNLPIRFQEVLQLTSLGIGANSIGFSTLTMESEKYICIRETTPDDKNNVVIINTDNP
SQILRKQIKTDAAIMNPKEPILALKIGQVLQLISIEQKMQLKSCQMQEPLEFWKWISPNT
LALVTATSVFHWTKEGNSEPVKIFERHPDLQNTEIINYRSDSTQNWLVLVAIHQRDGRVA
GRIQLYSVEKNISQSIEGHAACFANYTVPGATRPSTLFAISSRTPNASKILVLEVNKGDG
PAFQKRASDVFYPPEIGASDFPVAMQISEKYEIIYMVTKLGYIHLFDLGTASLIYRNRIS
SENIFVTAFEESTNGIIAVNRKGQVLSVSIDERNIIPYIVNTLNNVELAISMASKNNLPG
ADGLLSSQFERYFQQGQYKEAAKVAAESKGTVLRNLQTIQKFQSIPQVPDQPSPLLQYFG
MLLEKGKLNKIESLELVRPVLQQNKKQILEKWLTEDKLECSEELGDEVRRFDSKLALSIY
YRAGSSDKVITLFAEGGEFDKILAYCKKINYKPDFMYLLQRMASANPMGAADFAVKLVKE
EGGPYIDPNQVVELFAARNMIQETSNFLFAILTEDRAQDANLQTKLLEINLIHAPQNADA
IMGGQKFTHYNRIRIGGLCEKAGLYQRALEHYTDLADIKRVLSHAGHMVNHEFLVSYFGS
LNADDRMECMRDFLRTNPRQNLKLVVDIAVAYSDQMTPEAIIAMFESFRLYEGLYLYLTQ
IVVTSTSPEVHFKYIEAAAKVNQFKEVERMCRDSNYYDPEKTRDFLKEAKLQDQLPLIIV
CDRYQFITDLTNYLYKNNHTKYIEAYVQKINPSNTPLVVGALLDLDCQEDYLKSLIMNIN
VRNLIPADALVEQVEKRNRLKLLLPWLEAKVAESNMEPAIHNALAKIYIDSNKNPEAFLL
HNQFYDSKVVGKYCEKRDPYLSFVAYKRGLCDYELIEVTNKNTLFKNQARYLVERQDQDL
WAYVLSDQNEYKRSLIDQVVQTALPESTNAAEVSATVKAFMDADLPNELIELLEKIVIEG
KEFKNAKELQNLLILTAVRADKSRVMDYINRLENFDGSKLAPIAIESGLFEEAFFMYKKF
QFNVEAIEVLLNNINSIERAHDFAERCNQTEVYSKLAVAQLRADMVNECIESFIKANDTE
YYQEVVSAAERTNKYDDLVKFLQMCRKKIKEPAIESELIFAYAKVNKLAEMEDFINSPNS
AHIQVVGDRCFENGLYEAAKILYTNISNFPRLTSCLVKLGQFQAAVDAARKANSTKTWKE
VSAACIDAKEFRLAQVCGINIIVHGDELEELIRQYEDRGYFNELISLLESGLASERAHVG
MFTELAILYSKYKEEKLMEHLKLFYSRLNVPKVIKACQANQQWPQLTYLYIHYDEHDNAI
QTMINHSIEAWDHVLFKETIPKVAKLDLYYSAISFYLEEQPLLINDLLSVLSPRIDHTRA
VSLIRSIGHLPLVKPYLVSAQDQNVAALNEALNELYVEEEDYEALRASIDANSNFGTIAL
AQKLEKHELLEFRRIAAYLYKKNNRWAQSVELSKKDKLYKDAIQSAADSKNAAIGEELLQ
YFVEQKNHSAFAACLYTCYDFLKPDVVIELAWKNNIINYSFPYLIQYVKEYTGKVDQLME
DFNTRQKKTEEEKEQQTMESQQYQPDLSNISYGYAATGGMLALPPAMGYQQQPQQQMYPN
QGMLGYNNQQQNYNQYGGF
NT seq 5100 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtagtaatttaccaattagatttcaagaagttcttcaacttacaagtttaggt
attggagccaattcaattggtttctctacattaacaatggagagtgaaaaatatatttgt
attcgtgaaactacaccagacgataaaaacaatgttgttattattaatacagataatcca
tcacaaattcttagaaaacaaattaaaactgatgcagccatcatgaatccaaaagaacca
attttagcacttaagattggtcaagttttacaattaatttcaattgaacaaaaaatgcaa
ttaaaatcatgtcaaatgcaagaaccattggaattttggaaatggatttcaccaaataca
ttagcattggttacagcaacatcagtttttcattggactaaagaaggaaatagtgaacca
gttaaaatttttgaacgtcatccagatttacaaaacacagaaattattaattatcgttca
gattcaacacaaaattggttagtattagttgcaattcaccaaagagatggtcgtgttgct
ggtcgtattcaattatattcagttgaaaagaatatcagtcaatcaattgaaggtcatgct
gcttgttttgccaactatactgtaccaggtgctacccgtccatcaacattatttgccatt
tcctcaagaactccaaacgcttcaaaaattttagtcttagaggtcaataaaggtgatggt
ccagcattccaaaaacgtgcttcagacgttttctatccaccagaaattggtgcatctgat
ttcccagtcgccatgcaaatctctgaaaaatatgaaatcatctatatggtcaccaaatta
ggttatattcatctttttgatttaggaactgctagtctcatctatagaaatcgtattagt
agtgaaaatatttttgttactgcttttgaagaatcaaccaatggcatcattgctgttaat
agaaaaggtcaagttttatctgtttcaatcgatgaaagaaatattattccgtatattgta
aacactttaaataatgtcgaacttgccatctctatggcctctaaaaataacttaccaggc
gctgatggtttactttcaagtcaattcgaaagatatttccaacaaggacaatataaagaa
gctgcaaaggttgctgctgaatctaaaggtaccgttttaagaaatcttcaaactattcaa
aaattccaatccattccacaagtaccagatcaaccatcaccacttcttcaatactttggt
atgttattagaaaaaggtaaactcaataaaattgaatcacttgaattagttcgtccagtt
cttcaacaaaataaaaaacaaatccttgaaaaatggttaactgaagataaacttgaatgc
tcagaagagttaggtgatgaagttagaagattcgattccaaattagccctttcaatttac
tatcgtgctggttcatcagataaagttattaccttatttgccgaaggtggtgaattcgat
aaaattcttgcttactgtaagaagatcaattataaaccagatttcatgtatttattacaa
cgtatggcttcagccaatccaatgggtgctgctgattttgcagttaaacttgttaaagaa
gaaggtggtccatacattgatccaaatcaagttgtcgaactctttgctgcccgtaatatg
attcaagaaaccagtaatttcctttttgctattcttactgaagatcgtgctcaagatgct
aacctccaaaccaaacttttagaaatcaatttaatccatgccccacaaaatgctgatgcc
attatgggaggccaaaaattcacacattacaaccgtattagaattggtggtctttgcgaa
aaagctggtctctaccaacgtgctcttgaacattacactgatttagccgatatcaaaaga
gttttatcacatgctggtcatatggttaaccacgaattccttgtttcctactttggttca
ttaaatgctgatgatcgtatggaatgtatgcgtgatttccttcgtaccaacccacgtcaa
aatcttaaattggttgtcgatattgctgttgcctacagtgatcaaatgaccccagaggct
atcatcgcaatgttcgaatcattccgtctctatgaaggtctttacctttatttaacccaa
attgttgtcacatccacttcaccagaggttcactttaaatacattgaagctgctgccaaa
gttaatcaattcaaagaggttgaacgtatgtgcagagacagtaactattatgatccagaa
aagactcgtgatttcttaaaagaagctaaactccaagatcaacttccattaatcattgtt
tgtgatcgttatcaattcattaccgatcttaccaactatctttacaaaaataatcacact
aaatatattgaagcttacgttcaaaaaatcaatccatcaaataccccattagtcgttggt
gctttattagatctcgattgtcaagaagattacttaaaatcactcattatgaacatcaat
gtcagaaatttaattccagctgatgctttagttgaacaagtcgaaaagagaaatcgtctt
aaacttttacttccatggttagaagctaaagttgctgaatcaaacatggaaccagccatt
cacaacgctcttgctaaaatttacattgacagcaataagaacccagaagctttcctctta
cacaatcaattctatgacagcaaagttgttggtaaatattgcgaaaagagagacccatat
ctctcatttgttgcttacaaacgtggtctttgtgattacgagttaattgaagtcaccaac
aaaaatactcttttcaagaatcaagctcgttatttagtcgaacgtcaagatcaagatctt
tgggcttacgtcttatccgatcaaaatgaatacaagagatcattaattgaccaagtcgta
caaactgctcttccagaatcaaccaatgctgctgaagtttctgccaccgttaaagctttc
atggatgctgatcttccaaacgaattaattgaattactcgaaaagatcgttattgaaggt
aaagaatttaaaaacgctaaagaactccaaaatcttttaattcttactgccgttcgtgcc
gataaaagtcgtgttatggattacatcaatcgtttagaaaactttgatggctcaaaatta
gcaccaattgccatcgaaagcggtctctttgaagaagccttctttatgtacaagaaattc
caattcaatgttgaagctatcgaagttttattaaacaatatcaactctatcgaaagagct
catgatttcgctgaacgttgtaaccaaactgaagtttacagtaaattagccgttgctcaa
ttaagagccgacatggtaaacgaatgcattgaatcattcattaaagctaacgacaccgaa
tactaccaagaagttgtttctgctgctgaaagaaccaataaatatgatgatttagttaaa
ttcctccaaatgtgccgtaagaagattaaagaaccagccatcgaaagtgaattaatcttt
gcctacgctaaagttaacaaattagccgaaatggaagattttatcaattcaccaaactct
gcacacattcaagttgttggtgatcgttgtttcgaaaatggtctctatgaagctgctaaa
attctttacaccaatatttccaacttcccacgtcttactagttgtcttgttaaattaggt
caattccaagctgctgttgatgctgctcgtaaagccaatagcaccaagacctggaaggaa
gttagtgctgcttgcattgacgctaaagaattccgtttagctcaagtttgtggtattaat
atcattgtccatggtgatgaattagaagagttaattcgtcaatacgaagacagaggttac
tttaacgaattaatttcacttttagaaagtggtttggcttcagaacgtgctcatgttggt
atgtttaccgagttagccatcctctattctaaatataaagaagaaaaattaatggaacac
ttaaaattattctacagccgtcttaatgttccaaaagttattaaagcttgtcaagctaat
caacaatggccacaacttacctacctttacattcactatgatgaacacgataatgctatt
caaactatgattaatcattcaatcgaagcttgggatcatgttcttttcaaagaaactatt
ccaaaagttgccaaacttgacctctattatagtgccatttcattctatttagaagaacaa
ccattactcattaatgatctcctctctgttctttcaccacgtattgatcatacccgtgct
gtttcactcattcgttcaattggtcatctcccattagtcaaaccatacctcgtttcagct
caagaccaaaatgtagccgcccttaatgaggctcttaacgaactctacgttgaagaagaa
gactatgaagctcttagagcatcaatcgacgccaacagtaactttggtactattgctctt
gcacaaaaacttgaaaaacatgaactcctcgaattccgtcgtattgctgcctatttatac
aaaaagaataaccgttgggctcaatcagtcgaactctccaaaaaagataaactctataaa
gatgccattcaatcagctgctgacagtaaaaacgccgccattggtgaagagcttcttcaa
tattttgtagaacaaaaaaatcacagcgcttttgctgcttgtctttatacttgttatgat
ttcctcaaaccagatgttgttattgaacttgcttggaaaaataatatcatcaactactct
ttcccatatctcattcaatacgttaaggaatacaccggcaaagttgaccaactcatggaa
gatttcaatacccgtcaaaagaaaactgaagaagaaaaagaacaacaaaccatggaatca
caacaataccaaccagatctttcaaatatttcatatggttatgctgccactggtggcatg
ttagctcttccaccagctatgggatatcaacaacaaccacaacaacaaatgtatccaaat
caaggtatgttaggttacaataatcaacaacaaaactataaccaatatggtggtttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system