KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_46241Help
Entry
DICPUDRAFT_46241  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00020  Citrate cycle (TCA cycle)
dpp00310  Lysine degradation
dpp01100  Metabolic pathways
dpp01110  Biosynthesis of secondary metabolites
dpp01130  Biosynthesis of antibiotics
dpp01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DICPUDRAFT_46241
  Amino acid metabolism
   00310 Lysine degradation
    DICPUDRAFT_46241
Enzymes [BR:dpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     DICPUDRAFT_46241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl GCV_H HlyD_D23 Biotin_lipoyl_2 HlyD_3 RnfC_N DUF3306
Motif
Other DBs
NCBI-GeneID: 10499063
NCBI-ProteinID: XP_003285678
JGI: Dicpu1_46241
UniProt: F0ZE13
Position
Unknown
AA seq 354 aa AA seqDB search
MGDSISEGTIVSWTKNVGDQVRVDEVVCAIETDKVTIDINAPVSGTIMELFAKEGETVMV
GNDLYKIAKGEVAAPAPKAAEAPKPAAEAPKEAPKAAAPAPKPAEAPKAAPAPKSTPAPS
TEASETRVKMTRIRSRTAQRLKDSQNTAAMLTTFNELDMSALMGMRKQYKDEFEKKHGVK
FGFMSAFVKASSIALKEQPIVNASVEGDEIVYHNNVHINVAVSAPRGLVVPVIRNCDKLS
FADIEKELGRLSGLARNDGLAIEDSVGGTFTISNGGVFGSMFGTPIINPPQSAILGMHAI
KDRPYVVNGQVVVRPIMYLALTYDHRIIDGREAVTFLKKIKDVLENPERILLEL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggtgattcaatttcagaaggtactattgtatcatggaccaaaaatgttggtgatcaa
gttagagtagatgaagttgtttgtgcaatcgaaactgataaagttacaattgatatcaat
gctccagtttcaggtacaatcatggaattatttgccaaagaaggtgaaactgttatggtt
ggtaatgatttatataaaattgctaaaggtgaagttgctgccccagctccaaaagctgct
gaagctccaaaaccagctgccgaagctccaaaagaagcaccaaaagctgctgccccagct
ccaaaaccagctgaagctccaaaagctgctccagctccaaaatcaactccagccccaagc
actgaagccagtgaaactcgtgttaaaatgacccgtattcgttcaagaaccgctcaaaga
ttaaaagactcacaaaatactgctgctatgttaaccactttcaatgaactcgacatgagt
gctctcatgggtatgagaaaacaatacaaagacgaattcgaaaagaaacacggtgtcaaa
tttggtttcatgagtgcttttgtcaaagcttcaagcattgccctcaaagaacaaccaatc
gttaacgcttcagtcgaaggtgacgaaatcgtttaccacaataacgtccacatcaatgtt
gccgtctctgccccaagaggtttagttgtcccagtcattcgtaattgcgacaaactctca
tttgctgatatcgaaaaagaacttggccgtctttcaggtcttgctcgtaacgatggttta
gccattgaagatagtgttggtggtacattcaccatttcaaatggtggagttttcggttca
atgtttggtactccaatcatcaatccaccacaatcagccattctcggtatgcacgctatt
aaagatagaccatacgttgtcaatggtcaagttgttgtcagaccaattatgtatttagct
cttacttatgatcacagaattatcgatggtagagaagccgtcactttcttaaagaagatt
aaagatgttctcgaaaacccagaaagaattttattagaattataa

DBGET integrated database retrieval system