KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_46241Help
Entry
DICPUDRAFT_46241  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    DICPUDRAFT_46241
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DICPUDRAFT_46241
  Amino acid metabolism
   00310 Lysine degradation
    DICPUDRAFT_46241
Enzymes [BR:dpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     DICPUDRAFT_46241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 354 aa AA seqDB search
MGDSISEGTIVSWTKNVGDQVRVDEVVCAIETDKVTIDINAPVSGTIMELFAKEGETVMV
GNDLYKIAKGEVAAPAPKAAEAPKPAAEAPKEAPKAAAPAPKPAEAPKAAPAPKSTPAPS
TEASETRVKMTRIRSRTAQRLKDSQNTAAMLTTFNELDMSALMGMRKQYKDEFEKKHGVK
FGFMSAFVKASSIALKEQPIVNASVEGDEIVYHNNVHINVAVSAPRGLVVPVIRNCDKLS
FADIEKELGRLSGLARNDGLAIEDSVGGTFTISNGGVFGSMFGTPIINPPQSAILGMHAI
KDRPYVVNGQVVVRPIMYLALTYDHRIIDGREAVTFLKKIKDVLENPERILLEL
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgggtgattcaatttcagaaggtactattgtatcatggaccaaaaatgttggtgatcaa
gttagagtagatgaagttgtttgtgcaatcgaaactgataaagttacaattgatatcaat
gctccagtttcaggtacaatcatggaattatttgccaaagaaggtgaaactgttatggtt
ggtaatgatttatataaaattgctaaaggtgaagttgctgccccagctccaaaagctgct
gaagctccaaaaccagctgccgaagctccaaaagaagcaccaaaagctgctgccccagct
ccaaaaccagctgaagctccaaaagctgctccagctccaaaatcaactccagccccaagc
actgaagccagtgaaactcgtgttaaaatgacccgtattcgttcaagaaccgctcaaaga
ttaaaagactcacaaaatactgctgctatgttaaccactttcaatgaactcgacatgagt
gctctcatgggtatgagaaaacaatacaaagacgaattcgaaaagaaacacggtgtcaaa
tttggtttcatgagtgcttttgtcaaagcttcaagcattgccctcaaagaacaaccaatc
gttaacgcttcagtcgaaggtgacgaaatcgtttaccacaataacgtccacatcaatgtt
gccgtctctgccccaagaggtttagttgtcccagtcattcgtaattgcgacaaactctca
tttgctgatatcgaaaaagaacttggccgtctttcaggtcttgctcgtaacgatggttta
gccattgaagatagtgttggtggtacattcaccatttcaaatggtggagttttcggttca
atgtttggtactccaatcatcaatccaccacaatcagccattctcggtatgcacgctatt
aaagatagaccatacgttgtcaatggtcaagttgttgtcagaccaattatgtatttagct
cttacttatgatcacagaattatcgatggtagagaagccgtcactttcttaaagaagatt
aaagatgttctcgaaaacccagaaagaattttattagaattataa

DBGET integrated database retrieval system