KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_46840Help
Entry
DICPUDRAFT_46840  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dpp00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 909 aa AA seqDB search
MTNLVRFKVNYYTRLGQEVYISGTGEALGNWEEANSKKLHYCDNGDWETLVEFKGDEKEK
NIEYKYFIMDTNGEKIWESGPNRSLNLNDLNSNYIHEFRDTYQSPTSAENTYLDSSFFRE
VLFSRENKQAYSLVKNTSSDKVIIHFQVKSTYVPPTHSIYIVGSNSALGNWRTDRAVKLS
DEFYPVWKVDLEFSKEQLPFSYKYIIADKTKSYVHWEHGSDRWFTASTVHATEYSNTTNE
DRDFFFNDGEFKDSQLLRTAGVAVPVFSLRSKKGLGIGEFNDINALVDWSHQTGLHMIQI
LPINDTTVYYTWRDSYPYSSVSVYALHPIYIHIDSLTKDPKILATVAQHREKLNSLPALD
YEAVMNIKTTLLKEIYAQEKKSLGQNKEFTDFVKENSDWIKAYALYSVLRDTHKSGDFTT
WPVYSTITQEDIEKETSPSSKYYDSVCYYYFVQFHLHLQLLAASKYAVSKRIGLKGDLPI
GVNRVSVDAWVNPHLFRMNMSTGAPPDAFADDGQNWGFPTYNWEVMKKDDYAWWRSRLGQ
MSKYFHAFRIDHILGFFRIWEIPANCVTGLLGKFNPSLPLWRSELANNGVWDLDRLTQPY
IRYHTLREHFGEYADYTASKFLNEYSSNVYQLKPEFSTEKLIEQNLTADDAMYKPGLFKL
VQNVSLCADSEDENRFYPRIEITKTSNFNELSDDMKSTLHRLYISYFFERQEELWAQVAL
QRLPLIKKCTSMLVCGEDLGMVPKCVEPVLHDLGILGLRIQRMPSDSNKDFYHPNEYSYL
TVNTTSSHDMSTLRGWWEEDRARAQVFYNRILGMFGDAPYFCEPYVSEAVIAQHLHSSSM
ISIFPLQDWFGLSTEYGKRDPKEEKINEPSNPMHYWRYRVHVNLEDLIEDTDFSKNIQRL
LLSSNRNLD
NT seq 2730 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatttagttagatttaaggtcaactattacactcgtttaggtcaagaggtttat
atatctggaacaggtgaagctttaggtaactgggaagaagcaaactcaaaaaaacttcac
tattgcgataatggcgattgggaaactttagttgaatttaagggtgatgaaaaagaaaaa
aatattgaatataaatacttcataatggatactaatggtgaaaaaatttgggaaagtggt
ccaaaccgtagtttaaatttaaatgatttaaattcaaattatattcacgaatttagagat
acttatcaaagcccaacttcagctgaaaatacttatttagattcatcattctttagagaa
gttctttttagcagagaaaataaacaagcttattcattagttaaaaatacttcatcagat
aaggtcattattcattttcaagttaaatcaacctatgtaccaccaactcattcaatttat
attgttggtagtaatagtgctttaggtaattggagaactgatagagcagttaaactttca
gacgaattttacccagtatggaaggttgatttagaattttcaaaagaacaattaccattc
tcttataaatatattattgccgataaaaccaaatcatatgttcactgggaacatggctca
gatagatggttcaccgctagcactgtccacgctactgaatattccaatactaccaatgag
gatcgtgactttttctttaatgatggtgaattcaaagatagtcaattattaagaactgca
ggtgtagctgtaccagtattctcattaagaagtaagaagggtttaggtattggtgaattt
aatgacattaacgctcttgtcgactggtcacaccaaactggcttacatatgattcaaatt
ctcccaattaacgatacaaccgtttactatacctggagagattcttatccatacagttca
gtctctgtttatgcactccatccaatttatattcacattgattcattaaccaaagatcca
aagattttagcaactgttgcccaacatcgtgaaaaattaaactctcttccagctttagat
tacgaagcagttatgaacattaaaaccactcttcttaaagaaatctatgcccaagaaaag
aaatcattaggtcaaaataaagaatttacagattttgttaaagaaaacagcgattggatt
aaagcttacgctctctactctgtcttacgtgacacccacaagagtggtgatttcactaca
tggccagtttattcaacaattactcaagaagatattgaaaaagaaacttcaccatcatca
aaatattatgacagtgtttgttactattactttgtacaattccatttacatcttcaatta
ttagccgcttctaaatacgccgtatcaaagagaattggtttaaagggtgatttgccaatc
ggtgtaaatagagtttcagtcgatgcttgggttaatccacatctctttagaatgaacatg
tcaactggtgcaccaccagatgcttttgctgatgatggtcaaaactggggtttcccaact
tataattgggaggtcatgaagaaagatgactatgcttggtggagatctcgtctaggtcaa
atgtctaaatacttccatgcttttagaattgatcacattcttggtttctttagaatttgg
gaaattccagccaactgtgttactggtttattaggtaaattcaatccatcacttccatta
tggcgttcagagttagcaaataatggtgtttgggatctcgaccgtttaacccaaccatat
attagatatcacactttaagagaacattttggtgaatatgctgactacactgcatctaaa
ttccttaacgaatactcatccaatgtctatcaattaaaaccagagttctccaccgaaaaa
ttaatcgaacaaaatttaacagccgatgatgccatgtacaaaccaggtcttttcaaatta
gtccaaaatgtttcattatgtgctgacagtgaagatgaaaatcgtttctatccaagaatt
gaaatcactaaaactagtaactttaatgaactttcagacgatatgaaatcaactcttcat
cgtttatatatctcttatttcttcgaaagacaagaagaattatgggctcaagttgcactt
caacgtttaccattaattaagaaatgtacatccatgttagtatgtggtgaagatcttggt
atggttccaaaatgtgttgaaccagttctccacgatcttggtattcttggtttaagaatt
caacgtatgccatctgacagtaacaaagatttttatcatccaaacgaatattcctatctt
accgttaatactacctcatcacacgatatgtctactttaagaggttggtgggaagaagac
agagctcgtgcacaagtattctacaacagaattctaggtatgtttggcgatgcaccatat
ttctgtgaaccatatgtttccgaagctgttattgctcaacacttacattcatcaagtatg
atttcaattttcccacttcaagattggtttggtttatcaactgaatatggcaagagagat
ccaaaagaagaaaagatcaacgagccatcaaatccaatgcactattggagatatagagtt
catgtcaatcttgaagatttaatcgaagatacagattttagcaaaaatattcaaagatta
cttttatcatcaaatcgtaatttagattaa

DBGET integrated database retrieval system