KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_47001Help
Entry
DICPUDRAFT_47001  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00010  Glycolysis / Gluconeogenesis
dpp00052  Galactose metabolism
dpp00500  Starch and sucrose metabolism
dpp00520  Amino sugar and nucleotide sugar metabolism
dpp01100  Metabolic pathways
dpp01110  Biosynthesis of secondary metabolites
dpp01130  Biosynthesis of antibiotics
dpp01200  Carbon metabolism
Module
dpp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
dpp_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DICPUDRAFT_47001
   00052 Galactose metabolism
    DICPUDRAFT_47001
   00500 Starch and sucrose metabolism
    DICPUDRAFT_47001
   00520 Amino sugar and nucleotide sugar metabolism
    DICPUDRAFT_47001
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    DICPUDRAFT_47001
Enzymes [BR:dpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     DICPUDRAFT_47001
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucokinase ROK Hydant_A_N BcrAD_BadFG
Motif
Other DBs
NCBI-GeneID: 10504198
NCBI-ProteinID: XP_003286770
JGI: Dicpu1_47001
UniProt: F0ZH76
Position
Unknown
AA seq 368 aa AA seqDB search
MVYNVLGDYSKLAVEVKKDNQYYIGIDIGGTNTRVVYATAKGDYYTIKEFLCSSVKVLLE
ELFIIQDTLLTEFVEPTFTTIDLAGPHLSKNKYKFTNYVESDNILLTEYLPKKLCPEGRY
AILNDLESGSYGIIPYIISGKSEEIFLNLITPEEAKEIPTNGVFVVLAAGTGLGVGLIHK
YGEEYRVIPSEFGHISICSDDGDCEQELFAKLSENIKNTEPSRKNYCLEYEDIVSGRGIQ
ALYMINKNQNEPARDNAEIATQATNAPANLDCTCVKTMKIHYKYLLRCAREISVGTFATG
VYLIGDNIVRNKNFVDSVKNQLEFEFKDHPKIEWLRHIPVFGQSALKNLNLIGTVYYGIN
AAKKLPSL
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggtctataatgttttaggggattacagcaaactcgctgtagaagttaaaaaagataat
caatattatattggtatcgatattggtggcaccaatacaagagtagtttatgctactgcc
aaaggtgattattataccatcaaggaatttttatgcagcagtgttaaagttcttcttgaa
gaattattcattattcaagatacccttttaactgaatttgtagaaccaacctttactact
attgatcttgccggtccacatctttcaaaaaataaatacaaatttaccaattatgtcgaa
tcagataatatccttttaactgaatatttaccaaagaaactttgtccagaaggtcgttac
gcaattttaaatgatctcgaaagtggttcctatggtattattccatatattatttctggt
aaatcagaagaaatctttttaaatttaattactccagaagaagctaaagaaatcccaaca
aatggtgtttttgttgttttagctgctggtacaggtttgggtgttggtttaatccataaa
tatggtgaagaatatagagttatcccatcagaatttggtcatattagtatttgctcagat
gacggtgattgtgaacaagaactttttgccaaattatcagaaaatattaaaaatactgaa
ccatcaagaaaaaattattgtttagaatatgaagatattgttagtggtcgtggtattcaa
gctttatatatgatcaataagaatcaaaatgaaccagctagagacaatgctgaaattgcc
actcaagctacaaatgccccagcaaatttagattgcacctgtgttaaaactatgaaaatc
cattataaatatcttttaagatgtgccagagaaattagtgttggtacatttgccaccggt
gtttatttaattggtgacaatattgttagaaataaaaactttgttgattcagttaaaaat
caattagagtttgaatttaaagatcatccaaagattgaatggcttcgtcatattccagta
tttggtcaatctgctctcaaaaatttaaatttaattggtacagtttattatggtattaat
gctgccaagaagttaccatctttataa

DBGET integrated database retrieval system