KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_49312Help
Entry
DICPUDRAFT_49312  CDS       T02090                                 

Definition
protein kinase, atypical group
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Protein kinases [BR:dpp01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   DICPUDRAFT_49312
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 2305 aa AA seqDB search
MTNENFGKFMKNVNDLIFELLNSSGIPEKIGGIMAIDELIDVDYDENATKITKLANYLRI
GLGFNDFTVMLMASKALGRLARSNGTLTAECVEFEVTRALEWLSGDRIEARRHAAVLVLK
ELAQNAPTLFYVHCSSFIDLIWVALKDPKVAIREGAVEALRACLDLISERESRLRLQWYQ
KIYDEAQKSFKANGSPESIHGSLITLSELLRKTGDFMHSKYKDVCDTVLKYKDHRDKLVK
KTVLVLFPRLAIFNPKEFVLNYFNACMIHLLAALRNQNERPTAFISLGEIAMAVGGAIKP
YLDSIVVMIKQGLSTKGKQFCPEVLTCISMLASAVGPSMYPNMQSILPQMIQSSGLTITL
TESLRDLSINLPTLIPHIQSKLLMLISQVLANKPFSEPGAPSPYRKSATPFQGGSVPQLG
QNSDVDPQMIALALKTLGSFDFSKHNLLEFVRECVVNYLDDDNIEIRREAAITCAQLMVR
TEEPAPTRGHSAVIVGEVLEKLLVVGIADPDPSIRKTVLSSLDPRFDHHLAQAENLRSLF
IALNDELFEIRELAITVIGRLTIRNPAYVMPSLRKTLIQLLTELEFSGDGKNKEESARLL
GHLISASEKLIKPYVEPILKALLPKLRDSNPRVASCVLAALGELSVVGGEEMSQHIDQLV
PLIIDTLQDQSSTSKREVALKTLGQLASSTGYVIKPFSKYPMLLDILLNAIKTERIPSIR
REVIKVLGILGSLDPYKHKMNELGKRREDQKTNDDKALNEVITISPSSEDYYPTVALTAL
MKILRDPSLNSHHTSVIQAVMYIFKSLSLKSIPFLPQIMPPFLHAMNTGEPLFREFVFQQ
LGSLVSIVKQHIRDYLGSVFDLIEKYWNSNLLIPIIKLVEEISSALNDEFKVYLPNLIPQ
MLNVLHTDRNNKRPATIKVLKALEVFGTNLDDYLHLVIPAVVKLFEQVDVTSQVRILAIQ
TIGRLCKKLNFSDYASRIIHPLARVLDSSDTELREETLNTLCALVFQLGSDYAIFIPMVG
KVLAKREIQSANYELLISKLLKNQQLMWSPGSGEEGFNNTRFTDNGIHNEDNSSSTPFEI
GVKKLKANEQHLKNAWETSQRSTKEDWSEWIRRFSVELLRESPSPALRSCLSLAQDYHPL
VKELFNAGFVSCWTELHEQFQEELVRSLEVALLSPNIPPEILQTLLNLAEFMELHEKPLP
IDIRTLGALAEKCHAYAKALHYKEAEFQQSPSSTIEALISINNQLQQPEAAIGILIYAQK
NHSVELKESWYEKLRRWEDALAAYEKKQKTDVNVGIENTLGIMRCLHALGEWERLSQLSV
DTWKSENIGDNTRVTIAPLAAAAAWNLSNWERMEEYVRGMNQDTVEGSFYRAILEVHHDN
FDNAQILIEHARALVDTELTALLGESYNRAYKVVVRLQQLSELEEIIEYKKCSDNPERRN
MIKNTWKTRLRGCQHNVDIWQSILAVHSLVISPHEELDMWLKFVGLCRKGSRLGLAQKTL
AMLMGKDPATSQFGGILPNTHPRITFAYIKQLWSAGAKQPAFEKLRTFVQALRDTDDLPL
QGRAYLKLGEWQLALGDTLNESSIPHIIASFKAATECDPNWYKAWHSWALINFEVVSHYE
QNGGSVEQIGNHLLPAVHSFFKSISLAPDRSLQDTLRLLTLWFKHGAQKEVEAALMQGFN
TISIDTWLHVIPQIIARIHAPVLPVRRLLHELIDIIGKEHPQALVYPLTVATKSQSPARL
AAAKTLMDKMRKHSATLVDQALPVSQELVRTAILWLEMWYEGLEEASRQYFGDHNPEAML
ATLAPLHQILEKGPETTSETSFLQAFGRDLQEALEWSKKYEKTRKEGDLNQAWDLYYQVF
RRIYKQLPQMSSLELQYVSPKLLNSNNMELAVPGTYKAGEPIVRIQSFSPTLSVIPSKQR
PRKLTIIGSDGLEYTFLLKGHEDLRQDERVMQLFSLVNTLLAANHETAKSHLSIRRFAVI
PLSPNSGLIGWVPHSDTLHTLIKDFRDSNKILLSIEHRLMLQMCSDYDNLTLLQKVEVFE
FALENSNSLDLHKVLWLKSRNSEVWLDRRTNYTRSLAVMSMVGYILGLGDRHPSNLMLDR
HTGHILHIDFGDCFEVAMHRDKYPEKIPFRLTRMLINAMEVSGIEGNFRITCEAVMTVLR
NNKESLMAVLEAFVHDPLINWRLLTPNENNNINKHKQNNSNAKIESDLIEDSPETTGSLK
SSPVHRQIARNQRVGVDEQVEAEIVPEALNERALSVINRVNKKLTGRDFNSNETLDVPDQ
VQKLIDQATSHENLCQLYIGWCSFW
NT seq 6918 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaaaattttggtaaatttatgaaaaatgtaaatgatttaatatttgaatta
ttaaattcaagtggtataccagagaaaattggtggaattatggcaatcgacgaattaata
gatgtagattatgatgaaaatgctactaagattacaaaattagcaaattatttacgtata
ggtttaggatttaacgattttacagtaatgttgatggcatcaaaagcattaggtagatta
gcaagatcaaatggtacattaacagcagagtgtgtcgaatttgaagtcacaagagcactc
gaatggttaagtggtgatagaatagaagctagaagacatgctgctgtgttggttttaaaa
gaattagcacaaaatgcaccaacacttttttatgtacattgtagctcttttatagattta
atttgggttgcactaaaagatccaaaggttgccattagagaaggtgctgtcgaagcactc
agagcttgcttagatttaatttcagaaagagaatcacgtcttcgtcttcaatggtaccaa
aaaatttatgatgaagctcaaaaatcttttaaagcaaatggctcacccgaatcaattcat
ggctcattaatcacattatcagaattattaagaaaaactggtgattttatgcattcaaaa
tataaagatgtttgtgatactgtattaaaatataaagatcatcgtgataaattagttaaa
aaaactgtattggtattattcccaagattagcaatttttaatccaaaagaatttgtatta
aattattttaatgcatgtatgatacatttattagcagctttacgtaatcaaaatgaaaga
ccaacagcatttatttcattaggtgaaattgcaatggcagttggtggagcaattaaacca
tatttagattcaattgttgtaatgattaaacaaggtttatcaacaaaaggtaaacaattt
tgtccagaagttcttacatgtatttcaatgttagcatcagcagtaggtccatcaatgtat
ccaaatatgcaatcaattttaccacaaatgattcagtcatcaggtcttaccattacttta
actgaatcacttagagatttatcaatcaatttaccaacacttatcccacatatccaatct
aaacttttaatgttaataagtcaagttttagcaaataaaccatttagtgaaccaggtgct
ccatcaccatacagaaagagtgcaactccattccagggtggttcggtaccacagttaggc
caaaactctgatgttgacccacaaatgattgctttagctttaaaaactttaggttcattc
gatttctcaaaacataatcttttagagtttgttagagaatgtgttgtaaattatttagat
gacgataatatcgaaattcgtagagaagccgcaattacttgtgctcaattaatggtacgt
accgaagagccagccccaactcgtggtcattctgctgttattgttggtgaagttttagaa
aaacttttagttgttggtattgctgatccagatccatccatccgtaaaactgttttaagt
tcattagatccacgtttcgatcatcacttggctcaagctgaaaaccttcgttctcttttt
attgctttaaatgacgaactttttgaaattagagaacttgcaattactgttattggtcgt
cttacaattagaaatccagcttatgttatgccatcactccgtaaaactttaattcaacta
cttactgaattggaattcagtggtgatggtaaaaataaggaagaaagtgcacgtttattg
ggtcatttaatttccgcttcagaaaaattaattaaaccttatgtagaaccaattctcaaa
gctttattaccaaaacttcgtgattcaaatccacgtgtagcatcatgtgttttagcagca
ttgggtgaactttcagttgttggtggtgaagaaatgtcacaacatatagatcaattggta
ccattaattattgatactctccaagatcaaagctcaacatccaaaagagaagtagcactt
aaaacacttggtcaattggcttcatcaactggttatgttattaaacctttcagcaaatat
ccaatgcttttagatattttattaaatgctatcaaaactgaaagaattccatcaattaga
agagaagttattaaagtattaggtattttaggttcattagatccatataaacataagatg
aacgaattaggtaaacgtagagaagatcaaaaaacaaatgacgacaaggcattaaatgaa
gtaattacaatttcaccatcatctgaagactattacccaactgttgctttaactgcatta
atgaaaattttaagagatccatcattaaattctcaccacacaagtgttatccaagctgta
atgtatatattcaagagtctttcattgaagagtattccatttttaccacaaattatgcca
ccattcctccatgctatgaatacaggtgaaccgttattccgtgaatttgttttccaacaa
ttgggctcattggtttcaatcgttaaacaacatatccgtgactatttaggtagtgttttt
gatttaatcgaaaaatattggaattcaaatcttttaatcccaatcattaaattagtagag
gagatttcatcagctcttaatgacgagttcaaagtttatttaccaaatttaattccacaa
atgttaaatgtacttcataccgatcgtaataataaaagaccagcaaccatcaaagtatta
aaagctcttgaggtttttggaaccaatttagatgattaccttcatttggtaataccagca
gtcgttaaattatttgaacaagtagatgttacctctcaagtcagaattttagctattcaa
accattggtagactttgtaaaaaacttaatttctctgattacgcatctcgtattattcat
ccattagctcgtgttttagatagttcagatactgaattaagagaagaaacattaaatact
ttatgtgcattagtattccaattgggtagtgattacgcaattttcattccaatggttggt
aaagtattagccaaacgtgaaattcaaagtgccaattatgaattacttattagtaaactc
ttaaagaatcaacaattaatgtggtcaccaggttcaggcgaagaaggtttcaataatacc
agatttacagataatggtatccataatgaagataattcaagttcaactccattcgaaatt
ggtgtaaagaaattaaaagcaaatgaacaacatcttaagaatgcatgggagacctcacaa
cgttccactaaagaagattggagcgaatggattcgtagattctctgtcgaattacttcgt
gaatcaccatcaccagctttacgttcatgtttatcattagcccaagattatcatccattg
gttaaagaattattcaacgctggtttcgtaagttgttggactgagcttcatgaacaattc
caagaagagttggtgagaagtttagaggttgcattgctttcaccaaatattccaccagaa
atccttcaaaccttattaaatttagccgaatttatggagcttcacgaaaaaccattacca
atcgatattcgtacacttggtgcactcgctgaaaagtgtcatgcatatgctaaagcttta
cattacaaagaagcagaattccaacagtcaccatcatcaaccatcgaggctttaattagt
attaataatcaacttcaacaaccagaggctgctattggtattttaatttatgctcaaaag
aaccatagtgttgaattaaaagaatcatggtatgaaaaattacgtcgttgggaagatgcg
ttagctgcttatgaaaagaagcaaaaaacagatgtaaatgttggcattgaaaatacatta
ggtattatgagatgtcttcatgcattaggtgaatgggaaagattatcacaactctctgta
gacacatggaaatcagaaaatattggcgataacacacgtgtaaccattgccccattagct
gccgctgctgcatggaatctttctaactgggaaagaatggaagagtatgtaagaggtatg
aatcaagacactgttgaaggctcattttaccgtgctattctcgaagttcaccatgacaat
ttcgataatgcccaaatattaattgaacatgctcgtgcccttgtcgatacagagttaact
gccttacttggtgaatcttataatagagcatacaaagtagtcgttcgtcttcaacaatta
tcagaactcgaagaaattattgaatacaagaaatgttcagataatccagaacgtagaaat
atgatcaagaacacatggaaaactcgtttaagaggttgtcaacacaatgtagatatttgg
caatcaattttagctgttcatagtttggttatttcaccacacgaagagttggatatgtgg
cttaagtttgtaggtttatgtagaaaaggttctcgtttaggtttagctcaaaaaacatta
gcaatgttaatgggtaaagatccagctacaagccaatttggtggaattttaccaaatacc
catccaagaattacatttgcctatatcaaacaactttggagtgctggagctaaacagcca
gcatttgaaaaacttcgtacatttgttcaagccctcagagacactgacgatcttccatta
caaggtcgtgcatacttgaaattaggtgaatggcaattagcattgggtgatacattgaat
gaatcatctattccacatattattgcatcatttaaagctgccacagagtgcgatccaaat
tggtataaagcttggcattcatgggctcttattaatttcgaagttgtttcacattacgaa
caaaatggtggatcagttgaacaaattggtaatcatttactcccagcagttcattcattc
tttaaatcaatttcattggccccagatcgtagtcttcaagatactcttcgtcttttaact
ctttggtttaaacatggtgctcaaaaagaagttgaagctgctctcatgcaaggttttaat
acaatttcaattgatacctggcttcatgttattccacaaattattgctcgtattcatgct
cctgtacttccagttcgtcgtttacttcacgaacttattgatattattggtaaagaacat
ccacaagctcttgtttatccattaactgtagctactaaatcacaatcacctgcacgtctc
gctgctgccaaaactcttatggataaaatgagaaaacactctgccactttagtcgatcaa
gctctcccagtaagccaagagttggttagaactgctattctttggttagaaatgtggtat
gaaggtttagaagaagcttcacgtcaatatttcggtgatcataatccagaggctatgttg
gccacattagccccacttcaccaaattcttgaaaaaggtcctgaaaccacatctgaaaca
tcattccttcaagcttttggaagagatttacaagaagctttggaatggagtaaaaaatat
gaaaagacacgtaaagaaggtgatcttaatcaagcttgggatctttattatcaagtcttt
agaagaatttataaacaattacctcaaatgtcatcattggagcttcaatatgtttcacca
aaacttttaaattcaaacaatatggagttagcagtaccaggtacatataaagcaggcgaa
ccaattgtcagaattcaatctttctcaccaactctctcagttattccatccaaacaacgt
ccaagaaaacttactattattggtagtgatggtttagaatatactttccttttaaagggt
cacgaagatcttcgtcaagatgaacgtgttatgcaattgttcagtttagtcaatacatta
ttagcagctaaccatgaaaccgcaaaatcacatctttcaattcgtcgtttcgctgttatc
ccattatcaccaaattctggtctcattggttgggtaccacacagtgataccttacatact
cttattaaagatttccgtgatagcaacaaaattcttttatcaattgaacatcgtttaatg
ctccaaatgtgctcagattacgataacctcacattgttacaaaaggtcgaagtattcgaa
tttgctttagaaaactcaaatagtttagatctccacaaggtactttggttaaaatctaga
aattcagaagtttggttagatagaagaacaaattatactcgttcgttggctgttatgagc
atggttggttatattttaggtttaggtgatcgtcatccatccaatctcatgttagatcgt
cacacaggtcatattttacatatcgattttggtgattgtttcgaagtagctatgcaccgt
gataaatatccagaaaagattccattccgtcttactcgtatgcttattaatgctatggaa
gtttcaggaattgaaggtaactttagaattacttgtgaagctgtaatgacagtattaaga
aacaataaagaatctttaatggccgttttagaagctttcgttcacgatccattaatcaac
tggcgtcttttaacaccaaacgaaaataacaatatcaacaaacataaacaaaataactcg
aatgccaagatcgaaagtgatttaattgaagactcaccagaaaccactggctcactcaaa
tcctcacctgtacatagacaaattgctcgtaaccaaagagttggtgttgatgaacaggtc
gaagctgaaattgttccagaagcattaaatgaaagagctctttctgttattaatcgtgta
aataaaaaattaactggtagagatttcaattcaaatgaaactttagatgttcccgaccaa
gttcaaaaacttattgaccaagctacttctcatgaaaatttatgtcaattatatattggt
tggtgtagtttttggtaa

DBGET integrated database retrieval system