KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_49836Help
Entry
DICPUDRAFT_49836  CDS       T02090                                 

Definition
urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:dpp00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:dpp00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 287 aa AA seqDB search
MATLIDNRYGKARVRVLRVFKGPNDHHKIFDFDCRVLLRGDEFQETYLTGDNSKVVATDT
MKNTVYVIAQKEEFKSLEEFGIILGRHFINTYSWVSGVEVSMKENMWHRIVTSNGKPHGH
SFTRDREVHTAVVTSTRGKSPVVVSGIDDVLIMKTTQSGFEGFHRDKYTSLKETKDRVFA
TVVTSNWTYNTLDVDYTKAYETLKQSVFDIFANTYSKSVQETLFLIAKDAIGKCSAIEQV
HLSLPNKHAFGFDFSRLNIENKNVVFQPVEEPSGLIEGTIKRVHARL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggccactttaattgacaacagatatggtaaagcaagagttcgtgttttaagagttttc
aagggaccaaatgaccatcacaaaattttcgatttcgattgtcgtgttttattaagaggt
gacgaattccaagaaacttatttaaccggagataatagtaaagttgttgctaccgatact
atgaagaacactgtttatgttattgcccaaaaagaagaattcaagagcttagaagaattt
ggtatcattttaggtcgtcattttatcaatacatattcatgggtcagtggtgtcgaggtt
agcatgaaggaaaatatgtggcaccgtatcgttacatcaaatggtaaaccacacggccat
tcattcactcgtgatagagaagttcataccgctgtcgtcacttcaaccagaggtaaatcc
ccagttgtcgtttccggtattgatgatgtccttatcatgaaaactacccagtccggtttt
gaaggtttccatcgtgacaaatacacctccctcaaagaaactaaagacagagtttttgcc
actgttgttacttcaaactggacctataatactttagatgtcgactacaccaaagcttat
gaaactctcaaacaatctgtatttgatatctttgccaatacctattcaaaatcagttcaa
gaaaccttatttttaattgctaaagatgccatcggtaaatgctcagccatcgaacaagtt
catttatcattaccaaataaacatgcttttggtttcgacttctcaagattaaatattgaa
aataagaatgttgttttccaaccagtcgaagaaccatcaggtttaattgaaggtaccatt
aaaagagttcacgcaagattataa

DBGET integrated database retrieval system