KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_49836Help
Entry
DICPUDRAFT_49836  CDS       T02090                                 

Definition
urate oxidase
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    DICPUDRAFT_49836
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    DICPUDRAFT_49836
Enzymes [BR:dpp01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     DICPUDRAFT_49836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 287 aa AA seqDB search
MATLIDNRYGKARVRVLRVFKGPNDHHKIFDFDCRVLLRGDEFQETYLTGDNSKVVATDT
MKNTVYVIAQKEEFKSLEEFGIILGRHFINTYSWVSGVEVSMKENMWHRIVTSNGKPHGH
SFTRDREVHTAVVTSTRGKSPVVVSGIDDVLIMKTTQSGFEGFHRDKYTSLKETKDRVFA
TVVTSNWTYNTLDVDYTKAYETLKQSVFDIFANTYSKSVQETLFLIAKDAIGKCSAIEQV
HLSLPNKHAFGFDFSRLNIENKNVVFQPVEEPSGLIEGTIKRVHARL
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggccactttaattgacaacagatatggtaaagcaagagttcgtgttttaagagttttc
aagggaccaaatgaccatcacaaaattttcgatttcgattgtcgtgttttattaagaggt
gacgaattccaagaaacttatttaaccggagataatagtaaagttgttgctaccgatact
atgaagaacactgtttatgttattgcccaaaaagaagaattcaagagcttagaagaattt
ggtatcattttaggtcgtcattttatcaatacatattcatgggtcagtggtgtcgaggtt
agcatgaaggaaaatatgtggcaccgtatcgttacatcaaatggtaaaccacacggccat
tcattcactcgtgatagagaagttcataccgctgtcgtcacttcaaccagaggtaaatcc
ccagttgtcgtttccggtattgatgatgtccttatcatgaaaactacccagtccggtttt
gaaggtttccatcgtgacaaatacacctccctcaaagaaactaaagacagagtttttgcc
actgttgttacttcaaactggacctataatactttagatgtcgactacaccaaagcttat
gaaactctcaaacaatctgtatttgatatctttgccaatacctattcaaaatcagttcaa
gaaaccttatttttaattgctaaagatgccatcggtaaatgctcagccatcgaacaagtt
catttatcattaccaaataaacatgcttttggtttcgacttctcaagattaaatattgaa
aataagaatgttgttttccaaccagtcgaagaaccatcaggtttaattgaaggtaccatt
aaaagagttcacgcaagattataa

DBGET integrated database retrieval system