KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_50006Help
Entry
DICPUDRAFT_50006  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     DICPUDRAFT_50006
Peptidases [BR:dpp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   DICPUDRAFT_50006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 984 aa AA seqDB search
MEDKSSISTPTIEQTFEEISTNNDSNVTNTTNETASDNINNEDQQPTSTSANEVSMEEQS
LPELNRLDVLEILRDIKQTPLTVGDLWSLVNMEWFSKFQEAIFTREELGQIDNSPFLISK
DNPDHLKPGVCENKDFATVPEKVWNKLQKIYGGGPTVTRKVSKSLIGNLIIDLKIPFPLK
VMKSSATSEVFDCYAFKSETIKVFKERACKLLNVEPINVRIWDYYNNNKHAELKDQEYVS
NSNLIENQLILLDERLPNGKWPQQADRYQTYSTNSRGDGDKRPGITGLGNLGNTCFMNSA
LQCLSNTYPLTKYFFTNKYEKDINKDNPLGCGGELATEYASLISDIWEGNRTSVYPRNFK
SQIERFAPQFAGYHQHDSQELLAFLLDGLHEDLNKVKKKPFFEGKDYDERPDEVIANEQW
GMHVARNDSVIVDWFQAQLKSKLVCPDCGKISITFDPFMYLSLPLPSEINKQFTYSYINS
SLVVERRQLSLSSNNCQVKDFLHKLGEEVGANPSHLVLSMNGKLMNPDFNLAERVYYMNR
EIVVYQLDTTQDNGFLVSVKSHTPSNSYFNIHIPLYFVIPSDVQSSADLYKFFLEKFKPL
LKEVESIQQIFDSNSKPPQEPQHDSECGSSGDQQDSNMVGTSANDSSVDDNSPSSSNTTT
TSTTTSTSTSNGHHHGSSDHYSSNNYNYNSRESNEPEKDPRFIFQMVDCSSYHKERIVFP
FKSNEIALVWEDPSLYLEYEKLSPDLTKNGGVRDVSPYNVDLEQCIDLFTTEEQLGPEDP
WYCSNCKKHQRAFKKFDIWSAPPILVVHLKRFSYKKHYRDKLDTLVKFPIKDLDLSKYVL
SKNQPPPIYDLFAVSNHYGSLGGGHYTAYALNEPETKEAKANGNSNGNGKWYKFDDSHVS
EANVENVESEAAYVLFYRRKDTYDEDFDLNKHLDAQENNSNENNNSNNYNGESNTTTTTT
TTTTSNDKMDIDNDYNSNSTNTLD
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atggaggataaaagcagtatatcaacaccaaccatcgaacaaacatttgaagaaatctca
acaaataatgatagtaatgttacaaatacaacaaatgaaacagcaagtgataatataaac
aatgaagatcaacaaccaacctcaacatcagccaatgaagtatcaatggaggaacaatca
ttaccagaactcaatagattagatgttttagaaattttaagagatatcaaacaaactcca
ttaacagttggtgatttatggtcacttgtaaatatggaatggttttcaaaattccaagag
gctatttttacacgtgaagagttgggtcaaattgataatagtccatttttaatcagcaaa
gacaatccggatcatcttaaaccaggtgtttgtgaaaataaagattttgctactgttcct
gaaaaagtttggaataaacttcaaaaaatttatggcggtggtccaactgttaccagaaaa
gtatcaaagagtctcattggtaatttaataattgacttaaaaatacccttcccattaaaa
gttatgaaatcatctgcaacttccgaagtttttgattgttatgcctttaaatctgaaacc
attaaagtcttcaaagagagggcatgcaaacttttaaatgttgaaccaatcaatgttaga
atttgggattattataataataacaaacatgctgaattaaaagatcaagaatatgtttca
aattcaaacttaattgagaatcaattaattttattagatgaaagattaccaaatggtaaa
tggccacaacaagctgatagatatcaaacatattcaacaaatagcagaggggatggcgat
aaaagaccaggtattacaggtttaggaaatcttggtaatacatgttttatgaattcagca
ttacaatgtcttagtaatacctatccattaacaaagtatttcttcaccaataaatatgaa
aaggatataaataaagataatccattgggatgtggtggtgaattggcaactgaatatgca
tcattaatatcagatatttgggaaggtaatcgtacaagtgtttatccacgtaatttcaag
agtcaaattgaaagatttgccccacaatttgcaggatatcatcaacatgactcacaagaa
ttattagctttccttttggatggtcttcatgaagatttaaacaaagttaaaaagaaacca
ttctttgaaggtaaagactatgacgaacgtccagatgaagtcatcgccaatgaacaatgg
ggtatgcatgttgctagaaacgatagtgttattgtcgattggttccaagctcaattgaaa
tccaagttagtttgtcctgattgtggaaagatctcaattacattcgacccattcatgtat
ttatctcttccattgccatctgagattaacaaacaattcacctactcatatatcaactcc
tcattagtggtagaaagacgtcaattatctttatcatcaaacaattgccaagttaaagat
ttcttacacaaattgggcgaagaagttggtgctaatccatcacatttagttttatcaatg
aatggcaaattaatgaacccagattttaatttagctgaacgtgtttattatatgaataga
gaaatcgttgtttatcaacttgatacaactcaagacaatggttttttagtttcagtcaaa
tctcataccccaagcaactcttattttaatattcatattccattatattttgtaattcca
agtgacgttcaatcatctgctgacctttacaaattcttcttagaaaagtttaaacctctc
ttaaaagaggttgaatcaatccaacaaatctttgatagcaactcaaaaccaccacaagaa
ccacaacacgattctgaatgtggtagcagtggtgatcaacaagattcaaatatggtagga
acaagtgcaaatgactcatccgtcgatgataactcaccatcaagtagcaataccacaaca
acatcaacaaccacctcaacatcaacctccaatggtcatcatcacggcagcagtgaccac
tactcctcaaataattataactataattcacgtgaatcaaacgaaccagaaaaagaccca
agattcattttccaaatggtcgattgctcctcatatcacaaagaaagaattgtattccca
tttaaatcgaatgagattgctttggtttgggaagatccatcattatatttagaatatgaa
aaacttagtccagatttaacaaagaatggtggtgttcgtgatgtatcaccatataatgta
gatttagaacaatgtattgatttattcactaccgaagaacaattgggtccagaagatcca
tggtattgtagcaattgtaaaaaacatcaaagagctttcaagaaatttgatatttggtct
gctcctccaattcttgttgtccacttaaaaagatttagctacaaaaaacactacagagat
aaactcgatacccttgttaaattcccaattaaagatcttgacctcagcaaatatgtctta
tcaaagaatcaaccaccaccaatctatgatctttttgcagtctccaatcactatggttct
ttaggaggtggtcattataccgcctatgctctaaatgaacctgaaaccaaagaagcaaaa
gccaatggtaacagtaatggtaatggtaaatggtataaatttgacgactctcatgtctca
gaagcaaatgttgaaaatgttgaatcagaggccgcctatgttctcttttatagaagaaag
gatacctacgatgaagattttgatttaaataaacatttagatgcccaagaaaataatagc
aatgaaaataacaacagtaataattataatggtgaatcaaatacaactacaacaaccaca
acaacaacaacttcgaatgacaaaatggatatcgataatgactacaatagcaattcaact
aacacgctcgattaa

DBGET integrated database retrieval system