KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_50145Help
Entry
DICPUDRAFT_50145  CDS       T02090                                 

Definition
1,4-alpha-glucan branching enzyme
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    DICPUDRAFT_50145
Enzymes [BR:dpp01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     DICPUDRAFT_50145
Exosome [BR:dpp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DICPUDRAFT_50145
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 683 aa AA seqDB search
MTTKIDYSKATDGTKVISDDPWLEPYADTLKRRFSHVQNTIKRFDENEGGLLNFSKGYEY
FGFNVTAEGVQYREWLPSAHEVYLVGDFNQWSKTSHKLNRDEYGRWSIFIPNDQNGNCPI
PHKSKIKIYLKLANGNWDYRIPAWIKRVEQTKENPVFDGVFWNPPVKYQFKHKAPLPPTD
LRIYEAHVGMSSELPEISTYTKFKDTVLPMVKELGYNAIQLMAIMEHAYYASFGYQVTNF
FAISSRFGTPEELMEMIDTAHEMGILVLLDVVHSHASKNVLDGLNQLDGSDHHYFHGGGR
GNHDVWDSRLFNYGSWEVMRFLLSNLRFYVDVYGFDGFRFDGVTSMIYYHHGLAPACSYG
DYFGPNVDEDGLSYLTMANEMLHRLNPNIITIAEEVTGLACLCRPVSEGGGGFDYRLGMG
IPDKWIELVKDQRDEDWNMGSIAHMLSNRRYKEKNIAYAESHDQSLVGDKTLAFWLMDKE
MYFHMSTLQPETPIIDRGMALHKMIRIITSSLGGDGYLNFMGNEFGHPEWVDFPREGNNN
SLHHARRRWDLYKDKLLRYNQLRQFDIAMNRLEEEWHWLSSGQAFISCKHEDDKVIVFER
AGLIFIFNFHPNKSFSDYRIGSGVEGKFVNALDSDREEFGGHCRIGKDNYHFTENFAWND
RPYSLKIYIPSRTCLVLKKVLDK
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccaagattgattatagcaaagctacagatgggaccaaagtaatttctgatgac
ccatggttagaaccatatgccgatactttaaaaagaagatttagccatgtacaaaataca
ataaagagatttgatgaaaatgaaggtggtttattaaatttttcaaaaggttatgaatat
tttggatttaatgttacagcagaaggtgttcaatatagagaatggctaccatcagcccac
gaagtctatttagttggtgattttaatcaatggagtaaaactagtcataaattaaataga
gatgaatatggtagatggagtatttttattccaaatgaccaaaatggtaattgtccaatc
ccacataaatctaaaattaaaatttatttaaagttagcaaatggtaattgggattataga
atcccagcatggattaaaagagtagaacaaactaaagagaatccagtatttgatggtgta
ttttggaatccaccagttaaatatcaattcaaacataaagcaccattaccaccaactgat
ttaagaatttatgaagcacatgttggtatgtctagtgaattaccagagatttcaacttat
acaaagtttaaagatacagtattgccaatggtcaaggagctcggttataatgctattcaa
ttaatggcaattatggaacatgcttattatgcttcgtttggttatcaagtcaccaatttc
tttgccattagtagtcgtttcggtacaccagaggaattaatggaaatgatagatacagct
cacgaaatgggtattttagtattgttagatgttgttcacagccatgcttcaaagaatgta
ttggacggtcttaatcaattggatggttcagatcatcattatttccatggtggtggtcgt
ggtaatcatgatgtttgggacagtagacttttcaattatggctcatgggaagtaatgaga
ttccttttatcaaatcttcgtttctatgttgatgtatatggttttgatggctttagattc
gacggtgtaacttcaatgatttattatcatcacggtttagctccagcatgttcttatggc
gactactttggtccaaatgtagacgaagatggtttatcatatcttactatggccaacgaa
atgcttcatcgattaaatccaaatattattactattgcagaggaagttaccggtttagct
tgtctttgtcgtccagtaagtgaaggtggcggtggttttgactatcgtttaggtatgggt
attccagataaatggatagagcttgttaaagaccaaagagacgaagattggaatatggga
tcaattgctcatatgctttcaaatcgtagatataaagaaaagaatattgcatatgccgag
tcacacgatcaatcattagtaggtgataaaactctagctttttggttaatggacaaagaa
atgtatttccatatgtcaactcttcaaccagaaactccaattattgaccgtggtatggcc
ctccataaaatgatccgtattattacttcatcacttggcggtgatggttatttaaacttc
atgggtaatgaatttggacatccagaatgggtcgatttcccacgtgaaggtaataataat
tcgcttcatcatgctcgtcgtagatgggatctctacaaggataaattacttagatacaat
caattacgtcaatttgatatcgctatgaatcgtttagaggaagagtggcattggttaagc
tctggacaagcttttattagttgcaaacatgaagatgacaaggttattgtattcgaacgt
gctggtctcatctttatttttaatttccatccaaacaagagtttttcagattatagaatt
ggttctggtgttgaaggtaaatttgttaatgctttagattccgatcgtgaagaatttggt
ggccattgtagaattggtaaggataattatcactttacagaaaatttcgcttggaacgat
agaccatattctctcaaaatttatattccatcaagaacttgtttagttttaaaaaaagtt
ttagataaataa

DBGET integrated database retrieval system