KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_50316Help
Entry
DICPUDRAFT_50316  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K08738  
cytochrome c
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    DICPUDRAFT_50316
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 111 aa AA seqDB search
MSTPMPVGNVANGETLFKARCAQCHTVNKGGVNKQGPNLYGLFGRKSGSVEGYSYSEANK
NAGIMWGEDTLFTYLENPKKFIPKTKMAFAGFKSAQDRADTIAYLHKESTA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtccactccaatgccagtcggtaacgttgctaacggtgaaaccttattcaaagccaga
tgtgcccaatgtcacactgtcaacaaaggtggtgtcaacaaacaaggtccaaatctctat
ggtcttttcggtcgtaaatcaggttcagtcgaaggttactcatactcagaagccaacaaa
aatgctggtatcatgtggggtgaagatactctctttacttacttagaaaacccaaagaaa
ttcattccaaaaactaaaatggcctttgctggtttcaaatcagctcaagatcgtgctgat
accatcgcttatctccacaaagaatccaccgcttaa

DBGET integrated database retrieval system