KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_52661Help
Entry
DICPUDRAFT_52661  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    DICPUDRAFT_52661
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     DICPUDRAFT_52661
Transfer RNA biogenesis [BR:dpp03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    DICPUDRAFT_52661
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 306 aa AA seqDB search
MAKINILELLSACKNLAEESGEIITSVFKSGDLNVQMKGEDDPMTQADLLSQQHIIGGLN
NLWSDLIIVGEESCEIPKTDKIPSINSLKQYENELEKKQPEFLSLDTKDLIIFIDPLDAT
REFTNGRVGCVMTLIGISYKGKPIAGVIYQPFVDADGIASKESSKWVGRSVWAVVGLPVV
GLKDKRAPEDVGKVILVTTASHNNQQVEDAINKIKPDKLIRTGGAGYKTLMVIENLADVY
VFPTVGTKLWDICGPHAILLAINGSLTDPFGNEIVYTNDPKKIDNKYGVVITIGDHQKYI
NLLNQK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagataaatatattggaattattatcagcatgcaagaacttagcagaagaatcg
ggtgaaattatcacatcagtatttaaatctggtgatttaaatgttcaaatgaaaggtgaa
gatgacccaatgacacaagcagatttattatcacagcaacatattattggtggattaaat
aatttatggtcagatttaatcattgtaggtgaagagtcatgcgaaataccaaaaactgat
aagatcccatcaatcaattcattaaagcaatacgaaaatgaactagaaaagaagcaacca
gagtttttatccttggatactaaagatttaattatattcattgacccattggatgcaact
agagaatttacaaatggacgtgtaggatgtgttatgacattaattggtatttcttacaaa
ggtaaaccaattgcaggtgtaatttatcaaccatttgttgatgctgatggtattgcatct
aaagaatctagtaaatgggttggtagatctgtatgggccgttgtaggtttaccagtagtt
ggattaaaagataaaagagcaccagaggatgtaggaaaggttattttggttactacagca
agtcataacaatcaacaagtcgaggatgctatcaataaaataaaacccgataaattaatt
agaactggtggtgctggttacaaaactcttatggtaattgaaaatcttgcagatgtttat
gttttcccaacagtaggtaccaagctttgggatatttgtggtccacatgccatcctttta
gcaataaatggtagtttaacagatccattcggtaatgaaatagtttatacaaatgatcca
aagaaaatagataataaatatggtgttgtaattacaattggtgaccatcaaaaatatata
aatttattaaatcaaaaataa

DBGET integrated database retrieval system