KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_52731Help
Entry
DICPUDRAFT_52731  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     DICPUDRAFT_52731
Peptidases [BR:dpp01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   DICPUDRAFT_52731
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 442 aa AA seqDB search
MRNIEDIPSKSQLIAHRPRGLINTSNTCFMNVILQSLTGCQLFLKVIKNIQDLDNLHIYP
TLNSFNQFYAEYFSTASTSTTSPTSPLKTNGNSVTSPPLSSSPSSSTSSTASLQQSQILN
QLPINPKYFNDIVKSFNSKVSPPSPQIISPPLLNTMAQVSKKKLKLHFLNSSLPLATICQ
QDAQEFLVFLLDLINEEFLTLLKDIDIKDEEKSLLSPSSSSSSSSSKDSSELNSDDWEVV
GKNGKTAVFTNSQQELPKTPISQIFSGVLRSSFNRTGQKESITVEPFYCLHLDIRPEEIN
SLEDALKFFMKPEIIEDYTCPNKKTEITASKSWSFESLPRILIIHLKRFAFESDASRKLD
KKISFPTQLPITTANSVHKKYSLLSVVSHHGRGLSQGHYTCDIFEQQKNIWIRYDDAQII
NDIKEKDVLEREAYLLLYQINN
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgagaaatattgaagatataccatccaaatcacaattaattgcccaccgtccaagaggt
ttaatcaatacttcaaatacatgttttatgaatgtaattcttcaatcgttaacaggttgt
caattattcttaaaagttattaaaaatattcaagatttagacaatttacatatttatcca
actttaaatagttttaatcaattttatgcagagtatttttcaacagcctcaacttcaaca
acatcacctacttcaccattgaaaaccaatggcaatagtgttacctcaccaccattatca
tcttcaccatcatcatcaacatcatcaacagcttctttacaacaatcacaaatattaaat
caactaccaattaatccaaaatactttaatgatatagtgaaaagttttaattcaaaggtt
tcaccaccatcaccccaaattatctcaccaccacttttaaatacaatggctcaggtttca
aaaaagaaacttaaacttcactttttaaatagctcattaccactcgctacaatttgtcaa
caagatgctcaagaatttttagtattcttactcgatttaattaatgaagagtttttaact
ttattaaaagatattgatattaaagatgaagaaaaatcattattatccccatcatcatca
tcatcatcatcatcatcaaaagatagttctgaattaaacagtgatgattgggaagttgtt
ggtaaaaatggcaaaactgcagtttttacaaatagccaacaagaattaccaaaaacacca
atatcacaaatcttttcaggtgttttaagaagtagcttcaatagaacaggccaaaaagaa
tcaattacagtcgagccattttattgtttacatttggatattagaccagaagaaattaac
agtttagaggatgcattaaaattctttatgaagccagaaattattgaggactatacttgc
ccaaataagaaaactgagatcacagcttcaaagtcatggtcatttgaatctctcccaaga
attttaataatccatttaaagagatttgcatttgaaagtgatgcctcaagaaaattagat
aagaaaattagtttcccaacccaattaccaatcacaacagcaaactctgttcataaaaaa
tattcacttctttccgtcgttagccaccacggtagaggtttatcccaaggccattacact
tgcgatattttcgaacaacaaaaaaatatttggattagatacgatgatgctcaaattatt
aacgatataaaagagaaagatgtcctcgaaagagaagcttaccttttattatatcaaatt
aataattaa

DBGET integrated database retrieval system