KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_52831Help
Entry
DICPUDRAFT_52831  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K17610  
calcineurin B homologous protein 1
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Protein phosphatases and associated proteins [BR:dpp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     DICPUDRAFT_52831
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 185 aa AA seqDB search
MGVNKSTLRTEEIEEIREDSLLFTQREIKKLYKRFKRLDKEEKGSINVEDFNQIPELSMN
PMLPRIISIFDVNRDGQVNFKQFVKTLSAFHPKADKTDKIKILFKIYDINNDGFITRDEI
ETILTMMVGKNLTKEQISSIVEETLNEADVNGKGKLDYEDFKASIGKSGCNTENMLSISI
HNSEL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtaaataaatcaactttaagaacagaagagatcgaagagattagagaggattca
ttattatttacacaaagagaaattaaaaaactatataaaagatttaaaagattagacaaa
gaagaaaaaggctcgataaatgtagaagattttaatcagattccagagttatcaatgaac
ccaatgttaccaagaatcatatcaatttttgacgtaaatagagatggtcaagttaatttc
aaacaatttgttaaaaccctctcagcatttcatccaaaagcagataaaacagataaaatt
aaaattctttttaaaatttatgacataaacaatgacggatttataacaagggacgaaata
gaaactattttaacaatgatggttggtaaaaatttaacaaaagaacaaatttcaagtatt
gttgaagaaacattaaatgaagccgatgtaaatggaaagggaaaattagattatgaagat
tttaaagcttcaataggtaaatcaggttgtaatactgaaaatatgttatcaatttcaatc
cataattcagaattgtaa

DBGET integrated database retrieval system