KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_53558Help
Entry
DICPUDRAFT_53558  CDS       T02090                                 

Definition
extracellular signal-regulated protein kinase
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 409 aa AA seqDB search
MPPPPPINDSSNYNENISYFVYGSQFTVPRRYSIVKCIGHGAYGVVCSARDNLTGEKVAI
KKISKAFDNLKDTKRTLREIHLLRHFKHENLISVKDILKPNSKDTFDDVYLVSELMDTDL
HQIISSPQPLSDDHCQYFVYQMLRGLKHIHSANVLHRDLKPSNLLINEDCLLKICDLGLA
RVEDATHQGFMTEYVATRWYRAPEVILSWNKYTKAIDIWSVGCIFAELLGRKPLFQGKDY
IHQITLIIETIGSPSEEDISNIANEQARQFIRNMGYVPKVNFANLFPKANPDAINLLERM
LCFDPNKRLTVEDALSHPYFSTLHDPSDEPICLHKFNLSFESWDLNRELLKELIYNEMLY
YHPDPNDSTMVYTDLNNPAFNIQSFQNNSNDLFNLFQQQKFQLQQQIKN
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaccaccaccaataaatgattcaagtaattataatgaaaatatatcatatttt
gtatatggctcccaatttacagtaccaagaagatattcaattgtaaaatgtataggtcat
ggtgcatatggtgttgtatgttcagctagagacaatttaaccggtgaaaaagttgcaatt
aaaaaaattagtaaagcatttgacaatttaaaggataccaaacgaactctaagagaaatc
catcttttaagacactttaaacacgaaaatttaatatctgttaaagatatactgaaacca
aatagcaaggatacatttgatgatgtatatttggtttcagaattgatggataccgatctt
catcaaattatttcatctccacaacctttatcagatgatcactgccaatactttgtctac
caaatgttaagaggtcttaaacatattcactctgcaaatgtacttcatagagatttaaag
ccaagcaacctattaatcaacgaagattgtctcttaaagatttgtgatttgggtttagct
cgtgttgaagatgccactcaccaaggttttatgactgaatatgttgcaactcgttggtat
agagccccagaagtaattttatcctggaataaatatacaaaagctattgatatttggtct
gtcggttgtatttttgcagagctattaggtagaaaaccattattccaaggaaaagattat
attcatcaaattacattgattattgaaactattgggtcaccatcagaagaagatattagt
aatattgcaaatgagcaagcacgtcaattcattagaaatatgggctatgtgccaaaagtt
aattttgcaaatctattcccaaaagcaaaccccgatgctattaatctattagaaagaatg
ttatgctttgatccaaataaaagattaacagtagaagatgcattgtcacatccatatttt
tccacattacacgatccatccgatgaaccaatttgtttacataaattcaatttaagtttt
gaatcgtgggatttaaatagagaactcttaaaagaattaatatataacgaaatgttgtac
taccatccagatccaaatgatagcaccatggtttacaccgatttaaataatcctgccttt
aatattcaaagttttcaaaataatagcaatgacctttttaatttattccaacaacaaaaa
ttccaattacaacaacaaatcaaaaattaa

DBGET integrated database retrieval system