KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_53558Help
Entry
DICPUDRAFT_53558  CDS       T02090                                 

Definition
(RefSeq) extracellular signal-regulated protein kinase
  KO
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    DICPUDRAFT_53558
Enzymes [BR:dpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     DICPUDRAFT_53558
Protein kinases [BR:dpp01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   DICPUDRAFT_53558
Chromosome [BR:dpp03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     DICPUDRAFT_53558
Exosome [BR:dpp04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   DICPUDRAFT_53558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 409 aa AA seqDB search
MPPPPPINDSSNYNENISYFVYGSQFTVPRRYSIVKCIGHGAYGVVCSARDNLTGEKVAI
KKISKAFDNLKDTKRTLREIHLLRHFKHENLISVKDILKPNSKDTFDDVYLVSELMDTDL
HQIISSPQPLSDDHCQYFVYQMLRGLKHIHSANVLHRDLKPSNLLINEDCLLKICDLGLA
RVEDATHQGFMTEYVATRWYRAPEVILSWNKYTKAIDIWSVGCIFAELLGRKPLFQGKDY
IHQITLIIETIGSPSEEDISNIANEQARQFIRNMGYVPKVNFANLFPKANPDAINLLERM
LCFDPNKRLTVEDALSHPYFSTLHDPSDEPICLHKFNLSFESWDLNRELLKELIYNEMLY
YHPDPNDSTMVYTDLNNPAFNIQSFQNNSNDLFNLFQQQKFQLQQQIKN
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaccaccaccaataaatgattcaagtaattataatgaaaatatatcatatttt
gtatatggctcccaatttacagtaccaagaagatattcaattgtaaaatgtataggtcat
ggtgcatatggtgttgtatgttcagctagagacaatttaaccggtgaaaaagttgcaatt
aaaaaaattagtaaagcatttgacaatttaaaggataccaaacgaactctaagagaaatc
catcttttaagacactttaaacacgaaaatttaatatctgttaaagatatactgaaacca
aatagcaaggatacatttgatgatgtatatttggtttcagaattgatggataccgatctt
catcaaattatttcatctccacaacctttatcagatgatcactgccaatactttgtctac
caaatgttaagaggtcttaaacatattcactctgcaaatgtacttcatagagatttaaag
ccaagcaacctattaatcaacgaagattgtctcttaaagatttgtgatttgggtttagct
cgtgttgaagatgccactcaccaaggttttatgactgaatatgttgcaactcgttggtat
agagccccagaagtaattttatcctggaataaatatacaaaagctattgatatttggtct
gtcggttgtatttttgcagagctattaggtagaaaaccattattccaaggaaaagattat
attcatcaaattacattgattattgaaactattgggtcaccatcagaagaagatattagt
aatattgcaaatgagcaagcacgtcaattcattagaaatatgggctatgtgccaaaagtt
aattttgcaaatctattcccaaaagcaaaccccgatgctattaatctattagaaagaatg
ttatgctttgatccaaataaaagattaacagtagaagatgcattgtcacatccatatttt
tccacattacacgatccatccgatgaaccaatttgtttacataaattcaatttaagtttt
gaatcgtgggatttaaatagagaactcttaaaagaattaatatataacgaaatgttgtac
taccatccagatccaaatgatagcaccatggtttacaccgatttaaataatcctgccttt
aatattcaaagttttcaaaataatagcaatgacctttttaatttattccaacaacaaaaa
ttccaattacaacaacaaatcaaaaattaa

DBGET integrated database retrieval system