KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_55529Help
Entry
DICPUDRAFT_55529  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:dpp00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 285 aa AA seqDB search
MWYDNDVSKGLYTYPLKAVNEVDTQPLTETLTNFKWIDKSFCDHKPIHNQEDIEGFLFGC
DCKGDCFSNRDTCICIRESGITYDSNGGIDTVSDSILECNNLCKCSHEKCKNRIIQRSQN
NYSYPLELFKTPNKGWSVRAVIEIPKNSFVCEYVGEIITHKEADRRGSKYDSNGLSYLYD
LDYKGKEDCEVIDATFYGNVARFINHSCDPNLKKFFFFFDQRIEGSRARISFFSSKVIRE
GEELTFDYCYELPIGIEHLNEIEGAIPCHCGSKKCRKWLWVPNIS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtggtatgataatgatgtgtcaaaaggactttatacatatccattaaaggctgttaat
gaagttgatacccaaccattaaccgaaactctaaccaactttaaatggattgataaatca
ttttgtgaccataaaccaattcataatcaagaggatattgaaggcttccttttcggctgt
gattgcaaaggtgattgcttttcaaatcgtgacacttgtatatgtattagagaaagtggt
attacctatgactcaaatggcggcattgatactgtttcagattcaattttagagtgtaac
aatttatgcaaatgctctcacgaaaaatgcaagaatagaatcattcaacgttcccaaaat
aattattcctatccattagagttatttaaaacaccaaacaaggggtggagtgtcagagcg
gtaatagaaattccaaaaaatagttttgtttgtgaatatgtaggtgaaattattacacat
aaagaagcagatcgtcgtggttcaaaatatgatagtaacggcttaagttatttgtatgat
ttggactacaaaggaaaggaggattgtgaagtaattgatgcaactttttatggtaatgta
gcaagatttataaatcactcgtgtgatccaaatttaaagaaatttttcttcttttttgat
caaagaatagaaggttcaagagcaagaatttcattttttagctccaaagttatcagagag
ggcgaagaacttacctttgactattgttatgaattacccattggtattgaacatcttaat
gaaatcgagggtgctataccatgtcattgtggatcgaaaaagtgcaggaaatggctttgg
gttccaaatatttcttaa

DBGET integrated database retrieval system