KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_55529Help
Entry
DICPUDRAFT_55529  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    DICPUDRAFT_55529
Enzymes [BR:dpp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     DICPUDRAFT_55529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 285 aa AA seqDB search
MWYDNDVSKGLYTYPLKAVNEVDTQPLTETLTNFKWIDKSFCDHKPIHNQEDIEGFLFGC
DCKGDCFSNRDTCICIRESGITYDSNGGIDTVSDSILECNNLCKCSHEKCKNRIIQRSQN
NYSYPLELFKTPNKGWSVRAVIEIPKNSFVCEYVGEIITHKEADRRGSKYDSNGLSYLYD
LDYKGKEDCEVIDATFYGNVARFINHSCDPNLKKFFFFFDQRIEGSRARISFFSSKVIRE
GEELTFDYCYELPIGIEHLNEIEGAIPCHCGSKKCRKWLWVPNIS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgtggtatgataatgatgtgtcaaaaggactttatacatatccattaaaggctgttaat
gaagttgatacccaaccattaaccgaaactctaaccaactttaaatggattgataaatca
ttttgtgaccataaaccaattcataatcaagaggatattgaaggcttccttttcggctgt
gattgcaaaggtgattgcttttcaaatcgtgacacttgtatatgtattagagaaagtggt
attacctatgactcaaatggcggcattgatactgtttcagattcaattttagagtgtaac
aatttatgcaaatgctctcacgaaaaatgcaagaatagaatcattcaacgttcccaaaat
aattattcctatccattagagttatttaaaacaccaaacaaggggtggagtgtcagagcg
gtaatagaaattccaaaaaatagttttgtttgtgaatatgtaggtgaaattattacacat
aaagaagcagatcgtcgtggttcaaaatatgatagtaacggcttaagttatttgtatgat
ttggactacaaaggaaaggaggattgtgaagtaattgatgcaactttttatggtaatgta
gcaagatttataaatcactcgtgtgatccaaatttaaagaaatttttcttcttttttgat
caaagaatagaaggttcaagagcaagaatttcattttttagctccaaagttatcagagag
ggcgaagaacttacctttgactattgttatgaattacccattggtattgaacatcttaat
gaaatcgagggtgctataccatgtcattgtggatcgaaaaagtgcaggaaatggctttgg
gttccaaatatttcttaa

DBGET integrated database retrieval system