KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_55871Help
Entry
DICPUDRAFT_55871  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    DICPUDRAFT_55871
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     DICPUDRAFT_55871
Peptidases [BR:dpp01002]
 Metallo Peptidases
  Family M67
   DICPUDRAFT_55871
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 427 aa AA seqDB search
MTLVNIKPLYISSSVQELVEKHCSIGDIDKHYSLFNYLSTSNNLYKQAAQYKSEGDLEKS
YIYSIRFCSLLLEKLPKHPEYTKDVNKKSINDLKSKANQILSELESVKSVLDKGYILKVK
EEERQKELERIKQEKIRKIEEENKRKLEEEKKRKEEEQRLREIEDELNQSIKIDAEKKKK
NKDFIIDPSFVPPPEKEKPQPKLPPISLVEIPQDFATPATPATSTPANNIVKKPNIDSDE
ASKKYSKLRTINVDFKMFEDFMRLSENNTSRKIETCGILSGTLSNDVFTITTIIIPKQEG
TTDTCNTIEEHEIFEYQLEHDLLTLGWVHTHPTQECFLSAVDLHTHCSYQYLLQEAIAVV
IAPRSNPNFGIFRLTDPPGLETIQKCKLKSFHPHPPVNGVPVYTSCNHVKVSSGKFNGKV
IDLRNKK
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgacactagtaaatattaaaccactttatatatcatcatcggtacaagagttggtcgaa
aaacattgtagcataggagatattgataaacactatagtttatttaattatctatcaaca
tctaataatttgtataaacaagcagctcaatataaatccgagggtgatcttgaaaagtcc
tatatttactctatcagattttgtagtttattactagagaaattaccaaaacacccagaa
tataccaaagatgttaataaaaagtcaataaatgatttaaaatcaaaagcaaaccaaata
ttatcagaattagaatcagtaaaatcagtattagataaaggttatattctaaaagtaaaa
gaagaggaaagacaaaaggaattagaaagaataaagcaagaaaagattaggaaaattgaa
gaggaaaataagagaaagctcgaagaagaaaaaaaaagaaaagaagaggagcaaagatta
agagaaatcgaagatgaattaaaccaaagtataaaaattgatgctgagaaaaagaaaaaa
aataaagactttataatagacccatcatttgttcctcctccagaaaaagaaaaaccacaa
cctaaattaccaccaatatcattagttgaaattccacaagattttgcaacaccagcaaca
ccagcaacatcaacaccagccaacaatattgttaaaaaaccaaatattgattcagatgaa
gcatccaaaaaatattcaaaattaagaacaattaatgtagatttcaaaatgtttgaagat
tttatgagattatcagaaaacaatacaagtagaaaaattgaaacatgtggaattctttca
ggtacactttctaatgatgtatttacaatcacaaccattattatccccaaacaagagggt
acaacagatacatgcaacactattgaagaacatgaaatatttgaatatcaattggaacat
gaccttttaacattaggttgggtacatacacatccaacacaagaatgtttcttatcagct
gttgaccttcatactcattgttcatatcaatatttactccaagaggccattgctgttgtt
attgccccaagatccaatcctaattttggtattttccgtttaaccgatccaccaggttta
gaaactattcaaaaatgtaaattaaaatcattccatccccatccaccagttaatggtgtg
ccagtatatacaagttgcaaccatgttaaagtttcaagtggcaagtttaatggaaaggtt
atagatttacgaaataaaaaataa

DBGET integrated database retrieval system