KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_55932Help
Entry
DICPUDRAFT_55932  CDS       T02090                                 

Definition
UDP-glucose pyrophosphorylase 2
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:dpp00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:dpp00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:dpp00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:dpp00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 503 aa AA seqDB search
MMKQESTTSPLPQSPQLQSFGNRSSDLAVEDQFVKKLESIGQTAPNENIKKEFLNKEVSS
INKLFTRFLKNRKKVIDWEKIKPPPNEMVLNYKDLPQISHERTSELASKLAVLKLNGGLG
TTMGCTGPKSVIEVRSEKTFLDLTVQQIKEMNEKYNIKVPLVLMNSFNTHQETGKIIQKY
KYSDVKIHSFNQSRFPRILKDSLMPVPDKLFGNDSEWYPPGHGDVFFALQNSGLLETLLN
EGKEYLFISNVDNLGAVVDFNILNTMDKEKCEYIMEVTNKTRADVKGGTLIEYEGKAKLL
EIAQVPSNKVEEFKSIKKFKIFNTNNIWVNLKAIDRVLKENLLDDMDIIINPKVADGKSI
IQLEIAAGAAIEFFNNARGVNVPRSRFLPVKSTSDLFIVQSNLYSLEDGVLVMNKNRPFN
TVPLVKLGDLFKKVSDYQARIKGIPDILELDQLTVSGDVTFGSDMVLKGTVIIVAPAGNR
IDLPQGAEFENKVVSGNLRILDQ
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaacaagaaagcacaacttcaccattgccacaatcaccacaacttcaatcattt
ggaaatagatcatcagaccttgcagttgaggaccagtttgtaaaaaaattagagtcaatt
ggacaaactgcaccaaatgaaaatattaaaaaggaatttttaaataaagaagtttcttca
atcaataagctattcaccagattcctcaagaacagaaagaaggttattgattgggagaaa
atcaaaccaccaccaaatgaaatggttttaaattataaagatctcccacaaatctctcat
gaaagaacatcagaactcgcctctaaactagctgtcttaaaattaaatggtggtttgggt
actactatgggttgcactggtccaaagagtgtaattgaggttagaagtgaaaaaacattt
ttagatttaacagtacaacaaattaaggaaatgaatgaaaaatataatattaaagtacca
ttagtattaatgaattcattcaacactcatcaagaaactggtaaaatcattcaaaagtat
aaatattcagatgttaagattcattcattcaatcaatcacgtttcccaagaatcttaaaa
gatagtttaatgccagtcccagataaattgtttggtaatgactctgaatggtatccacca
ggtcatggtgacgttttctttgctttacaaaatagtggtctcttagaaacactcctcaat
gaaggtaaagagtatttattcatctcaaatgttgataatcttggtgccgttgtcgatttc
aatattttaaatactatggataaagaaaaatgtgaatatattatggaagttacaaacaaa
accagagctgatgttaaaggtggtacattaattgaatatgagggtaaagctaaattatta
gaaattgctcaagtaccatcaaataaagttgaagagtttaaatcaatcaaaaaattcaag
attttcaataccaacaacatttgggtcaacttaaaagctattgatcgtgtattaaaagaa
aatctattagacgatatggatattattatcaatccaaaagttgcagatggtaagagtatt
atccaattggaaattgctgctggtgctgctatagaattctttaataatgctcgtggtgtt
aatgtaccaagatcaagatttttaccagtcaaatcaacatcagatctttttattgtccaa
tcaaatctttattcacttgaagatggtgtacttgttatgaataaaaatagaccattcaat
actgttccattagtcaaattgggagatctcttcaaaaaagtatcagattatcaagctcgt
attaaaggtattccagatatccttgaattagaccaactcactgtttctggtgatgtaaca
tttggctcagatatggttctcaaaggtactgttattattgttgctccagcaggaaatcgt
atagatttaccacaaggtgctgaatttgaaaacaaggtagtctctggtaatttaagaatt
cttgatcaataa

DBGET integrated database retrieval system