KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_58194Help
Entry
DICPUDRAFT_58194  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Inositol phosphate metabolism
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:dpp00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:dpp04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 1485 aa AA seqDB search
MNTVTERNNNELNSNTSNDNNVNKISNSNNNNNNNNQDSLSQIDQHQQDKFKLKQQKLKE
RENYLEDILGKQISDFEEEMAEQIKKINSDPQNHHDDAHHNPVQEEHDRIEHEINEIKGV
YNKRNMEFHKDLRFEGQTRMREGSILNLEKQGLVKVISQRFQTPDTASYTRPAISNSSIK
DKILNMKKEQERKKLEMETQQREKVIILSEDSSSLQVYHPSVLIDRMNSKPGDKLETDNN
NLATTSTDNSASANNGNNITSVKPNTAAAPILVNSPIKLSPSALSTPSTLSSMPLSPIVA
NNPTKNNNNSGSPSNNPYITTNTISKDNKDKIKKDSKEKNKEKEKIKSKEKEKEKEKKQQ
VKNAPPNELIRKRRGRTLITPSVDAKKNLQIYFTIPEKPIQKVIPTKPILKPFTSTSQQF
LKDLVKESTDIKETTSKVEGSSLSLSFESEGSSLAINNNAEASLLNVTSLRVRALKTPFN
ILFILPNQSRKTLLVKGTDTIEVLKERLASEYLESFPKSNRYGSDSYLLLDFNNTPLEKT
LSLNKCEYILEKRSKGLLPKLKMIEKSDILEADSREELSPQEYDIIRKIIPNTSNLKGDE
VDYFRRVTSRQRYEALPHIKGSIQSTLLPRLSILPIPIVANKILISVFLPITQVTKTLDL
EPNETADAFTNRIFVKNYSKHLPNVNASDFILKVVGSSEYIHGPYDIRTFECIRNHIIQS
TKPQLTLIQRPKSELDPPPFKPRFDFPPELSIDCEVSDYRTDIWDQLTHFSIRDIKRPFC
VKVLGSSKIPMNCVKDEDTSIIVSISLYHGIDNFSKVFTRPLNPSTPSLSSDSLALDWNE
LLVFNNIEYSNLPIDARLSISIYSTNDSVDEQDIRNHDQSTKKLTPIGWANLMISDFRHQ
LRQGLVQLSLWPNEFSNPLGTCSNNPNPNSVNLILEFEEFDLPVIFPRNKKIPNVEPPTI
NSNDMRDFFESITNLDPLSDLKPDKYSQLWALRHYAMLFPSVLPRLMLSVPWMQAVAVDE
AYNLLERWPRLKPYEALELLDAKHANRKVRDFAVSCLEELSEDELLDILLQLVQVLKYEP
FHDTKLSRFLLRKAILHRSIGHSFFWYLKSDLHVLNLSERFGILLESYLYACGAHRVELL
KQLDVINNLTDVAKKIKPLKDQDRKDFMLKELESIDWPKRFHLTLNPRLESNGLIINKSK
YMDSKKLPLRLSFTNTDMNADPIEVIFKAGDDLRQDMLTLQMIRLMDKLWQKEGLDLKLS
PYGCISTGDMIGMIEVVLNAETTAKIQKSAGGATAAFKLDPLANWLLQHNKTEIEYQRAV
DTFILSCAGYCVATYVLGIGDRHNDNLMCTKLGRLFHIDFGHFLGNYKKKFGFKRECAPF
VFTPDFCYVMGGKESPKFAQFVNYCCTAYNILRKNAKLFMNLFAMMVSTGIPELQSMEDL
NYLKESFSLELSDDKARDKFINLIHESLSTKRTQLNNAIHIAFHP
NT seq 4458 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagttacagaaagaaataataacgaattaaatagtaatactagtaatgataat
aatgtaaataaaatatcaaatagtaataataacaacaacaacaacaaccaagattcatta
tcacaaattgatcagcatcaacaagataaatttaaattaaaacaacaaaaacttaaagaa
agagaaaattatttagaggatattttgggtaaacaaatttcggattttgaagaagagatg
gcagagcaaattaaaaagataaatagtgatcctcaaaatcatcatgatgacgcccaccat
aacccagttcaagaggagcacgatagaattgaacatgaaattaatgaaataaagggtgtt
tacaataaaagaaatatggaatttcataaagatttaagatttgaaggtcaaactagaatg
agagaaggttcaattttaaatttagagaaacaaggacttgtaaaagtaattagtcaaaga
tttcaaacaccagatacagcatcttatactagaccagcaatttcaaatagttcaattaaa
gataagattttaaatatgaaaaaagaacaagaaagaaagaaattggaaatggaaactcag
cagagagaaaaagttattatattatcagaggattcatcttctcttcaagtataccatcca
tcagttttaatcgatagaatgaatagcaaaccaggtgataaattagaaacagataataat
aatttagcaacaacatccacagataattcagcctctgctaataatggtaataatattaca
tcagtaaaaccaaatacagcagcagcaccaatattagtaaattcaccaattaaactatca
ccttcagctttgtctactccatcaacattatcatctatgccattatcaccaatagtcgcc
aataatccaactaaaaataataataatagtggtagtccatcaaataacccatatataaca
acaaatactatatcaaaagataacaaagataaaataaaaaaggacagcaaggaaaaaaat
aaagaaaaagagaaaatcaaaagtaaagaaaaagaaaaggaaaaagaaaagaaacaacag
gtcaagaatgctccaccaaatgaactcattagaaagcgtagaggcagaacattaattact
ccatccgtcgatgcaaagaaaaatcttcaaatttatttcacaattccagaaaaaccaatc
caaaaagttataccaaccaaaccaatattaaaaccatttacatcgacatcacaacaattt
ttaaaggatttggttaaagaatcaactgatattaaagaaacaacaagtaaagtagagggt
tcaagtttatcactttcatttgaaagcgaaggttcttctttggcaataaataataatgct
gaggcatctttattaaatgttacatctcttagggttagggctttaaagacaccatttaat
atattatttattttaccaaatcaatcaagaaagacactgttagttaaaggaaccgataca
atcgaagttttaaaagaaagattagcatcagaatatttagaatcatttccaaaatcaaat
cgttatggatcagattcatatttacttttagattttaataatactccactagaaaaaacc
ctatcactcaataaatgtgaatatattttagaaaagagatcaaaaggtttattacccaaa
ttaaagatgatcgagaaatctgatattttggaggccgattcaagagaggaactttcacca
caagaatatgatatcattcgtaaaattataccaaataccagtaatttgaagggcgatgaa
gttgattattttagaagggttacatcaagacaaagatacgaagcattaccacatattaaa
ggctccattcaatcaacattgttaccacgtctctccattttaccaattccaattgtagct
aataaaattttaatttctgtatttttaccaatcactcaagtcaccaaaacattagattta
gaaccaaacgaaacggcagatgcttttacaaaccgtattttcgtaaagaattactctaaa
catttaccaaatgtaaatgcatcagattttattttaaaagttgtcggtagctcagagtat
attcacggtccatatgatattagaacattcgagtgtataagaaatcacattatccaaagt
accaaaccacaacttacacttatacaaagaccaaagagtgaattagatccacctccattt
aaacccagattcgatttcccaccagaactttcaatcgattgtgaagtttcagattatcgt
acagatatttgggatcaattaactcatttttcaattagagatataaagagaccattctgt
gttaaagttttaggttcatcaaagattccaatgaattgtgttaaagatgaagatacaagt
attatagtttcaatatcactttatcatggtatcgataatttttcaaaagtctttacaaga
ccactcaatccatcaaccccatcattatcatcagactctttagcattagattggaacgag
cttttagttttcaataatatcgaatattcaaatttaccaattgatgcaagactttcaatt
agtatttactctacaaacgattcagtagatgaacaagatataaggaaccacgatcaatcc
actaaaaaattaacaccaatcggttgggctaatttaatgataagcgatttcagacaccaa
ttaagacaaggtttagttcaattatcattgtggccaaatgaattttcaaatccattaggt
acatgttcaaataatccaaatccaaattcggtcaatttaattttagagtttgaagagttt
gatttaccagtaattttcccaagaaataaaaagataccaaatgtagaaccaccaactatc
aattcaaacgatatgagggactttttcgaatcaatcaccaacttggatccactttcagat
ttaaagccagacaaatattcacaactttgggctcttagacattacgcaatgttattccca
tcagttttaccaagattaatgttaagtgtaccttggatgcaagctgtagcagtcgatgag
gcatacaatctattagagagatggccaagattaaaaccatatgaagctttagaattatta
gatgcaaagcatgccaatagaaaagttagagattttgcagttagttgcctcgaagagtta
agcgaagatgaactcttggatatcctattacaattggttcaagtattaaaatatgaacca
ttccacgacactaaactttcaagattccttttaagaaaagccattttacatcgtagtata
ggtcattcattcttttggtatttgaaatcagatttacatgtattaaatctttcagaaaga
tttggtattcttttagaaagctatttatatgcatgcggtgcacatagagtcgaattactc
aaacaattagatgtaatcaataatttaaccgatgtagctaaaaagataaaacctttaaaa
gatcaagatagaaaggactttatgcttaaagaacttgaatcgatagattggccaaagaga
ttccacttgactttaaatccacgtttagagtccaatggtttaatcattaataaaagcaaa
tatatggatagtaagaaattaccacttcgtttatcatttacaaataccgacatgaacgcc
gacccaatagaggttatttttaaagctggtgatgatttaagacaagatatgttaactctt
caaatgattcgtcttatggataaactttggcaaaaagaaggtctcgatttaaaactttca
ccatatggttgtatttctacaggtgatatgattggtatgatcgaggtggtattaaatgca
gaaacaacagcaaagattcaaaagagtgcaggtggtgccacagcagcatttaaactagac
ccacttgccaattggttattacaacacaataaaacagaaatcgaatatcaaagagcagtc
gatacattcatcctttcttgtgctggttattgtgtagctacttatgtacttggtatcggt
gatagacacaacgacaatcttatgtgtacaaaattaggtagattattccatatcgatttt
ggtcatttccttggtaattataaaaagaaatttggtttcaaacgtgaatgtgcaccattt
gtattcacccccgatttttgttatgtaatgggaggcaaagagtcacccaagtttgcacaa
tttgtaaattattgttgcactgcttataatatccttagaaagaatgcaaaactttttatg
aatctttttgcaatgatggtatccacaggtatcccagaattacaatcaatggaagattta
aattatctcaaagaatctttctctttagaattatctgacgataaagctagagataaattt
ataaatttaattcacgaaagtttatcaactaaaagaacacaattaaataatgcaattcat
attgcttttcatccataa

DBGET integrated database retrieval system