KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_58708Help
Entry
DICPUDRAFT_58708  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    DICPUDRAFT_58708
Enzymes [BR:dpp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     DICPUDRAFT_58708
Exosome [BR:dpp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   DICPUDRAFT_58708
  Exosomal proteins of colorectal cancer cells
   DICPUDRAFT_58708
  Exosomal proteins of bladder cancer cells
   DICPUDRAFT_58708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 456 aa AA seqDB search
MFFAPWCGHCKNLKPHYEEAAKTLSTNKKIALGKVDCTVQEELCQLNKVQYYPTLVVYKN
GKAEPFEAERNAKSIVVALEEELKPNVASLESNEEIEEFKKSNPIGVVGFFDNDHDDRYK
LFTDLASSQKKHAKFAAVIGKDFSKDHVKATPNVVLYRKFDEPSVAHEGDFEIEALKNFV
SGNVVPLVGEINRETYKKYESVAVPLAYLFLDSTQDNKDTLAFVGKIAKENKGKIVFCWV
DMKKFPQQATHMGLSGEVTPALSIDDSANLKARFNFEEKSDFTAESVKQWVSDVLNNKVA
PFVKSQPIPEKNDGPVKVAVGHTFKELVLDSPNDVLVEFYAPWCGHCKKLEPIYNKLGEF
MKDIKSVDIVKIDADSNDVPSSLEIKGYPTIMLFKAGDKENPVQYDGQRNNHMDFAEFIH
DKAAIKFELPSNTEEDDEDEGEPIVSNKKESKHDEL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgttctttgccccatggtgcggtcactgtaaaaacttaaaaccacactacgaagaagcc
gccaaaactttatctaccaacaagaaaatcgccttaggtaaagttgactgtactgttcaa
gaagaactctgtcaattaaacaaagttcaatactacccaactttagttgtttacaaaaac
ggcaaagctgaaccattcgaagctgaaagaaacgccaaatcaattgtcgttgctttagaa
gaagaattaaaaccaaacgttgcatcattagaatcaaatgaagaaatcgaagaattcaaa
aagagcaacccaattggtgttgttggtttctttgataacgatcatgatgatagatacaaa
cttttcaccgatttagccagttcacaaaagaaacacgctaaattcgctgctgttattggt
aaagatttctcaaaagatcacgttaaagccacaccaaatgttgtattatacagaaagttt
gatgaaccatctgttgcccacgaaggtgattttgaaattgaagctcttaaaaactttgtt
tctggtaatgttgttccattagttggtgaaattaaccgtgaaacctacaagaaatacgaa
tcagttgccgttccattagcttatcttttcttagattcaactcaagacaacaaagatacc
ctcgcattcgttggtaaaatcgccaaagaaaacaaaggtaaaattgttttctgttgggtc
gatatgaagaaattcccacaacaagccacccatatgggtctctctggtgaagtcacccca
gctctttcaattgacgactctgccaacttaaaagcccgtttcaactttgaagaaaaatca
gacttcaccgccgaatctgttaaacaatgggttagcgacgtcttaaacaacaaagttgct
ccattcgtcaaatcacaaccaatcccagaaaagaacgacggtccagtcaaagttgccgtt
ggtcacactttcaaagaactcgtcttagatagcccaaatgatgttcttgttgaattctac
gctccatggtgcggtcactgtaaaaaactcgaaccaatctacaacaaacttggtgaattc
atgaaagacatcaaatctgttgacattgttaagatcgatgccgactctaatgacgttcca
tcatcactcgaaattaaaggttacccaaccattatgttattcaaagctggtgataaagaa
aacccagtccaatatgacggtcaaagaaataaccacatggactttgctgaattcattcac
gataaagctgccattaaattcgaattaccatcaaacactgaagaagatgatgaagacgaa
ggtgaaccaattgtatcaaataaaaaagaatctaaacatgatgaattataa

DBGET integrated database retrieval system