KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_58708Help
Entry
DICPUDRAFT_58708  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K09580  protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    DICPUDRAFT_58708
Enzymes [BR:dpp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     DICPUDRAFT_58708
Chaperones and folding catalysts [BR:dpp03110]
 Protein folding catalysts
  Protein disulfide isomerase
   DICPUDRAFT_58708
Membrane trafficking [BR:dpp04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    DICPUDRAFT_58708
Exosome [BR:dpp04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   DICPUDRAFT_58708
  Exosomal proteins of colorectal cancer cells
   DICPUDRAFT_58708
  Exosomal proteins of bladder cancer cells
   DICPUDRAFT_58708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 OST3_OST6 Calsequestrin Thioredoxin_7 Thioredoxin_8 Thioredoxin_2 Glutaredoxin DUF1936
Motif
Other DBs
NCBI-GeneID: 10505188
NCBI-ProteinID: XP_003293872
JGI: Dicpu1_58708
UniProt: F1A2H6
Position
Unknown
AA seq 456 aa AA seqDB search
MFFAPWCGHCKNLKPHYEEAAKTLSTNKKIALGKVDCTVQEELCQLNKVQYYPTLVVYKN
GKAEPFEAERNAKSIVVALEEELKPNVASLESNEEIEEFKKSNPIGVVGFFDNDHDDRYK
LFTDLASSQKKHAKFAAVIGKDFSKDHVKATPNVVLYRKFDEPSVAHEGDFEIEALKNFV
SGNVVPLVGEINRETYKKYESVAVPLAYLFLDSTQDNKDTLAFVGKIAKENKGKIVFCWV
DMKKFPQQATHMGLSGEVTPALSIDDSANLKARFNFEEKSDFTAESVKQWVSDVLNNKVA
PFVKSQPIPEKNDGPVKVAVGHTFKELVLDSPNDVLVEFYAPWCGHCKKLEPIYNKLGEF
MKDIKSVDIVKIDADSNDVPSSLEIKGYPTIMLFKAGDKENPVQYDGQRNNHMDFAEFIH
DKAAIKFELPSNTEEDDEDEGEPIVSNKKESKHDEL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgttctttgccccatggtgcggtcactgtaaaaacttaaaaccacactacgaagaagcc
gccaaaactttatctaccaacaagaaaatcgccttaggtaaagttgactgtactgttcaa
gaagaactctgtcaattaaacaaagttcaatactacccaactttagttgtttacaaaaac
ggcaaagctgaaccattcgaagctgaaagaaacgccaaatcaattgtcgttgctttagaa
gaagaattaaaaccaaacgttgcatcattagaatcaaatgaagaaatcgaagaattcaaa
aagagcaacccaattggtgttgttggtttctttgataacgatcatgatgatagatacaaa
cttttcaccgatttagccagttcacaaaagaaacacgctaaattcgctgctgttattggt
aaagatttctcaaaagatcacgttaaagccacaccaaatgttgtattatacagaaagttt
gatgaaccatctgttgcccacgaaggtgattttgaaattgaagctcttaaaaactttgtt
tctggtaatgttgttccattagttggtgaaattaaccgtgaaacctacaagaaatacgaa
tcagttgccgttccattagcttatcttttcttagattcaactcaagacaacaaagatacc
ctcgcattcgttggtaaaatcgccaaagaaaacaaaggtaaaattgttttctgttgggtc
gatatgaagaaattcccacaacaagccacccatatgggtctctctggtgaagtcacccca
gctctttcaattgacgactctgccaacttaaaagcccgtttcaactttgaagaaaaatca
gacttcaccgccgaatctgttaaacaatgggttagcgacgtcttaaacaacaaagttgct
ccattcgtcaaatcacaaccaatcccagaaaagaacgacggtccagtcaaagttgccgtt
ggtcacactttcaaagaactcgtcttagatagcccaaatgatgttcttgttgaattctac
gctccatggtgcggtcactgtaaaaaactcgaaccaatctacaacaaacttggtgaattc
atgaaagacatcaaatctgttgacattgttaagatcgatgccgactctaatgacgttcca
tcatcactcgaaattaaaggttacccaaccattatgttattcaaagctggtgataaagaa
aacccagtccaatatgacggtcaaagaaataaccacatggactttgctgaattcattcac
gataaagctgccattaaattcgaattaccatcaaacactgaagaagatgatgaagacgaa
ggtgaaccaattgtatcaaataaaaaagaatctaaacatgatgaattataa

DBGET integrated database retrieval system