KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_76580Help
Entry
DICPUDRAFT_76580  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:dpp04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 402 aa AA seqDB search
MRINYFLVILLIAFISIESVFGFYSDKGDVINLNKKNFKQQVLEGDGNVMVEFYAPWCGH
CKSLKPEYEKAAKNVKGLVKIAAINCDEEKELCGQYQIQGFPTLKFFATQKNGKKQPEDY
QGGRTASAIVKFALSKLPNYSTKVTEDNLSKFLTSTPSAKALLFTSKSTTSDLYKALSVD
FRNTLPLGEARNIKKETLEKYQVTSFPTLLVFTSDDQETFVKYEGKLEHSSLFKFLQPHS
SKKSGDNKKEETTTTTNSDPNDPALEKFVEIKDSKSFEKTCSSGLCVVALFDQLDDKEAN
DKYLELLNAIATEFKGRMKFVWIDSSVHDKIVTQFDLSGLPNMFVLNPNKMRYTPFLGSF
SEDSIKSFFKSVLSGLKNAVPYKEQPKFNDLEKKETKKKDEL
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgagaattaattattttttagttattcttttaattgcatttatttcaattgagtctgta
ttcggtttttattcagataaaggagatgttatcaatttaaataaaaagaatttcaaacaa
caagttttagagggtgatggtaatgttatggtagaattctatgccccatggtgcggtcat
tgtaaaagtcttaaaccagagtacgaaaaagcagcaaagaatgtcaagggtttagttaaa
atcgctgcaattaattgtgatgaagaaaaagaattatgtggccaataccaaatccaaggt
ttcccaacattaaaattctttgcaacccaaaagaatggtaaaaaacaaccagaagactat
caaggtggtcgtactgcctctgctattgttaagtttgctttatcaaagttaccaaactac
tcaaccaaagttactgaagacaatttatctaaattccttacctcaactccatcagccaag
gctttattattcacaagtaaatctactacatctgatctctataaagctctttctgtcgat
ttccgtaacactcttccattgggtgaagctagaaatattaaaaaagaaacccttgaaaaa
tatcaagttacctctttcccaactcttttagttttcacaagtgatgaccaagaaaccttt
gttaaatatgaaggtaaattagaacattcatcattattcaaatttttacaaccacacagc
tcaaagaaatcaggcgataacaaaaaagaagaaaccaccactaccaccaactctgaccca
aatgacccagctttagaaaaatttgtcgaaattaaagattcaaaatcatttgaaaagact
tgctcatcaggcctttgtgttgtagctttattcgatcaactcgatgataaagaagccaac
gataaatatttagaactcttaaacgccatcgctacagaattcaaaggtagaatgaaattt
gtttggatcgattcatcagttcacgataaaattgttactcaatttgacttgtctggttta
ccaaatatgtttgttttaaatccaaataaaatgagatacactccattccttggttcattc
tctgaagattccatcaaatccttcttcaaatcagtcttaagtggtcttaaaaacgccgtt
ccatacaaagaacaaccaaaatttaatgatttagaaaaaaaagaaactaaaaagaaagat
gaattgtaa

DBGET integrated database retrieval system