KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_76798Help
Entry
DICPUDRAFT_76798  CDS       T02090                                 

Definition
acireductone dioxygenase
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:dpp00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 149 aa AA seqDB search
MKSYFYDNQEDVVSLDYLKEHNVLYFPMDMENDNYKEPLEQLCKERGYKNRDEVKLNKET
PGLEDKLKIFFEEHLHDDEEIRFILDGCGFFDVRDKNDKWIRIRVEKGDLIIVPANMYHR
FTLDETRKIHAMRLFTDAPKWVPINRHQN
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagttatttttacgataaccaagaagatgttgtatcacttgactatttaaaagaa
cacaatgttttatatttcccaatggatatggaaaacgataactataaagaacctttagag
caattgtgcaaagaaagaggatacaagaatagagatgaagttaaattaaataaagaaact
ccaggcttagaagataaattaaaaatattttttgaagaacatttacatgacgacgaagaa
attagatttattttagacggttgtggattttttgatgttagagacaaaaatgataaatgg
attagaattagagttgaaaagggtgatttaattattgttccagcaaacatgtatcatcgt
ttcacattagatgaaactagaaaaatccatgcaatgagattattcactgatgccccaaaa
tgggttccaattaacagacatcaaaactaa

DBGET integrated database retrieval system