KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_76975Help
Entry
DICPUDRAFT_76975  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Enzymes [BR:dpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     DICPUDRAFT_76975
Chromosome [BR:dpp03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    DICPUDRAFT_76975
   HAT complexes
    NSL complex
     DICPUDRAFT_76975
    MSL complex
     DICPUDRAFT_76975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 548 aa AA seqDB search
MALSEEIIENEQDNIENKENEEEQIENKEEEEEEEENENEEEEEDNKDEEEEEEESISAA
VEEIEDDDDDDEKEEENSKSTEKEDDEEDEEEEEEDDEEEREEVAPISTRNKRQRTENVQ
SKTANKKSAPTSNTTNGTHSNKENEQPQQNITEPNSNRKVLEIGTHIYCRWRDDQYRKCE
IIDKREAESESGTFDYYVHYHEFNRRLDEWVHESRMDFSRIESENKPNVPLAEIQSDGQF
RKVTRQIKRKYEEMNHIQKGADEDNKLSAIEKEHEEITKVKNINVIELGRYEIDTWYFSP
YPEEFAKCDKLFLCEFCLKYMKKKKTLNRHKLKCDLRHPPGNEIYRSGNLSMFEVDGKKN
KIYCQNLCLLAKLFLDHKTLYYDNAIKEVATWLAISKEKDSPDGYNLACILTLPPYQRKG
FGKLLISFSYELSKKENKVGTPEKPLSDLGLLSFRSYWTQVLLEILRKHKGNLSILDISN
MTSIRTEDVISTLQSLNLIRYWKGQHIISVTPKAIEEHLKVYSKQSSRIDPKCIRWAPLN
PPTAEKHR
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atggcactatccgaagaaatcatcgaaaatgaacaagataatattgagaataaagaaaat
gaagaagaacaaatagaaaataaagaggaagaagaagaagaagaagaaaatgaaaatgaa
gaagaggaagaagataacaaagatgaggaggaggaggaggaagagtcaatatcagctgct
gtcgaagaaattgaagatgacgatgatgatgacgaaaaagaagaagaaaatagtaaaagt
acagaaaaagaagatgatgaagaagatgaagaggaggaagaagaagatgatgaagaagag
agggaagaggttgcaccaatatcaacaagaaataaaagacaaagaaccgaaaatgtacaa
agtaaaacagcaaataaaaaatcagcacccacatcaaatacaacaaatggtactcactcc
aataaagagaatgaacaaccacagcaaaacattacagagccaaattcaaatagaaaagtt
ttggaaattggtacacatatttattgccgttggagagatgaccaatatcgtaaatgtgaa
attattgataaaagagaagcagagtcagaatcaggcacattcgattactatgtacattac
cacgagttcaatcgtcgtttggatgaatgggtacacgagagtagaatggatttcagtcgt
atagagtcagaaaataaaccaaatgtaccattggcagagattcaatcagatggtcaattt
agaaaagtcacacgtcaaattaaaagaaagtatgaagagatgaaccacattcaaaagggt
gccgatgaagataacaaattgtcagctatagaaaaagaacacgaagagatcaccaaagta
aagaatattaatgttatagagttgggtcgttatgaaattgacacatggtatttctcgcca
tacccagaagagtttgcaaaatgtgataagttattcctttgcgaattttgtctcaagtat
atgaagaaaaagaaaacacttaatagacacaaattaaaatgcgatcttcgtcatccacca
ggaaatgaaatctatagaagtggtaacctttcaatgtttgaagtcgatggcaaaaaaaat
aaaatctattgtcaaaatctttgtctcttggccaagttgtttttagatcacaaaactctc
tactatgataatgcgatcaaagaggttgccacatggttggctatttcaaaagaaaaagat
tcacccgatggttacaatcttgcttgtattttaacactaccaccctatcaacgtaaaggg
tttggaaaacttcttatctcattctcttacgaattatccaaaaaggaaaacaaggttggg
acaccagaaaagcctttatcagatttgggtttactcagttttagatcttattggacccaa
gttttattagaaattttaagaaaacataaaggtaatttatcaattttagatatatcaaat
atgacatctattagaaccgaggacgttattagtactcttcaatcattaaatttaattaga
tattggaaaggtcaacatatcatttctgtaacaccaaaagctattgaagagcatctcaaa
gtttattcaaaacaatcctcccgtattgatccaaaatgtatacgttgggcaccactaaac
ccacctaccgccgaaaagcatcgttaa

DBGET integrated database retrieval system