KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_77539Help
Entry
DICPUDRAFT_77539  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    DICPUDRAFT_77539
   03008 Ribosome biogenesis in eukaryotes
    DICPUDRAFT_77539
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.5  ribonuclease P
     DICPUDRAFT_77539
Ribosome biogenesis [BR:dpp03009]
 Eukaryotic Type
  Pre-60S particles
   RNases
    RNase MRP
     DICPUDRAFT_77539
Transfer RNA biogenesis [BR:dpp03016]
 Eukaryotic Type
  5'processing factors
   Ribonucrease P
    DICPUDRAFT_77539
Mitochondrial biogenesis [BR:dpp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   RNase MRP
    DICPUDRAFT_77539
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 207 aa AA seqDB search
MSDTEFVEDNQMEDNEDDLNSEDLEEAEERERNYEQYLLLNDPSKYTYLRRVVQRPQTKK
NEIYLSNNGKFLYYIKRAKKLLIDEKEKEIIIHGLGAAIPLAVNLSLQLQKDIQDLVLSP
TTSSEEIIDQYDPLTDDLEPVLKIRHASAIHIKIINKTEDPIPSESFNKTITFKSNKSKS
KINNRIDKKSTTTTTTKTTTTTTDNNK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatacagagtttgttgaagataatcaaatggaagataatgaagatgatttaaat
tctgaagatttagaagaggcagaagaaagagaaagaaattatgaacaatacttattatta
aacgatccatcaaaatatacttatttaagaagagttgtacaaagaccacaaactaaaaaa
aacgaaatctatttatcaaataatggtaaatttttatattatataaagagagcaaaaaaa
ctattaattgatgaaaaagaaaaagaaattattatacatggattaggtgcagcaattcca
ttagcagttaatttatcacttcaattacaaaaagatattcaggatctagttttatcacca
acaacatcatcagaagaaattatagatcaatatgacccattaacagatgatttagaacca
gttttaaaaatcagacatgcttcagcaattcatattaaaattataaataaaactgaagat
cctatcccgtccgaatcattcaataaaaccattacatttaaatctaataaaagcaaatca
aaaattaataatagaatcgataaaaagagtaccacaacaacaacaacaaaaacaacaaca
acaactaccgataataataaatag

DBGET integrated database retrieval system