KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_77539Help
Entry
DICPUDRAFT_77539  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K14527  
ribonuclease P/MRP protein subunit RPP20 [EC:3.1.26.5]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Ribosome biogenesis in eukaryotes
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:dpp03013]
Genetic Information Processing; Translation; Ribosome biogenesis in eukaryotes [PATH:dpp03008]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 207 aa AA seqDB search
MSDTEFVEDNQMEDNEDDLNSEDLEEAEERERNYEQYLLLNDPSKYTYLRRVVQRPQTKK
NEIYLSNNGKFLYYIKRAKKLLIDEKEKEIIIHGLGAAIPLAVNLSLQLQKDIQDLVLSP
TTSSEEIIDQYDPLTDDLEPVLKIRHASAIHIKIINKTEDPIPSESFNKTITFKSNKSKS
KINNRIDKKSTTTTTTKTTTTTTDNNK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatacagagtttgttgaagataatcaaatggaagataatgaagatgatttaaat
tctgaagatttagaagaggcagaagaaagagaaagaaattatgaacaatacttattatta
aacgatccatcaaaatatacttatttaagaagagttgtacaaagaccacaaactaaaaaa
aacgaaatctatttatcaaataatggtaaatttttatattatataaagagagcaaaaaaa
ctattaattgatgaaaaagaaaaagaaattattatacatggattaggtgcagcaattcca
ttagcagttaatttatcacttcaattacaaaaagatattcaggatctagttttatcacca
acaacatcatcagaagaaattatagatcaatatgacccattaacagatgatttagaacca
gttttaaaaatcagacatgcttcagcaattcatattaaaattataaataaaactgaagat
cctatcccgtccgaatcattcaataaaaccattacatttaaatctaataaaagcaaatca
aaaattaataatagaatcgataaaaagagtaccacaacaacaacaacaaaaacaacaaca
acaactaccgataataataaatag

DBGET integrated database retrieval system