KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_83521Help
Entry
DICPUDRAFT_83521  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Enzymes [BR:dpp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.20  elongation factor 2 kinase
     DICPUDRAFT_83521
Protein kinases [BR:dpp01001]
 Serine/threonine protein kinases: Atypical group
  Alpha family [OT]
   DICPUDRAFT_83521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 481 aa AA seqDB search
MEKYGTSYTENTFNPSISSIEEVEIIRYDVERKLLKKEVALAQIGSKIGSGGMRSAYHLT
LVKSNIKCVLKIQKHSPLGFKDLIRDNLSAETAHKYAKLFNDKNPPKKITINRPFILCFI
NRPGRPIAQIELFLEGSYKKYNTNTGYVDNDRNTPQAFSHFTFVASNKTELVVDIQGVND
CYTDLQIHTKEPNKYGQGNLGQKGIDSFFQSHKCNPICKWLGISQNQTNQISRKPSNHYE
NQNNLNNSNNSNNSNNSNKSSNSNNMNNMNNMNNNMNMINNFSSNNYNNNNVYNNYNMNN
NNCFDYNQNFYYQQPPIQPKYDININLNNQNYPLLQHNQYNHFVQQFPPNFNNNLFNSNN
NLQVTPQMYQPYDRTTFQNEPQALWLPQLQQNLKQEINHYQQKQQYDVQVLPPQYKDIKQ
KLPHKKHILNAEHKHIFGLLDKSKYLCVFCQKQFNSEMYMCISCKLTCCDNCSSILNIMD
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatatggaacaagttacacagaaaatacttttaatccatcaatttcatccata
gaagaagtagagatcattagatatgatgtcgaaagaaagttattaaaaaaagaagttgca
ttggcccaaattggaagcaaaattgggagcggtgggatgaggtcggcataccatttgacc
ctagtaaaatcaaatattaaatgtgttttaaagattcaaaaacactcacctttggggttc
aaggatttaattagagataatctatctgctgaaactgctcataagtatgctaaattattt
aatgataaaaatccaccaaagaagattacaattaatagaccttttatactatgttttata
aataggccaggtagacccatagcacaaatagaattgtttttagagggtagttataaaaaa
tataatacaaatactggatatgtcgataatgatagaaatacacctcaagcattcagtcat
tttacatttgtggcatcaaataaaactgaattagttgttgatattcaaggagtcaatgat
tgctatacagatttacaaattcatacaaaagaaccaaataaatatggacaagggaacctt
ggtcaaaaaggaattgattctttttttcaatctcataaatgtaatcctatttgcaagtgg
cttggaatttctcaaaaccaaaccaatcaaatatcaagaaagccttcaaatcattatgaa
aatcaaaataatttaaataatagcaataatagtaataatagtaataatagtaataaaagt
agtaatagtaataatatgaataatatgaataatatgaataataacatgaatatgattaat
aattttagcagtaataattataacaataataatgtttataacaattataatatgaacaat
aataactgttttgactataaccagaatttttattatcaacaaccaccaatacaaccaaag
tacgatattaatataaatttaaataatcaaaattaccctctattacaacacaatcagtac
aaccattttgttcagcaattccccccaaattttaataataatctttttaactccaataat
aatctacaggtaacaccccaaatgtatcagccatatgatcgaacaacctttcaaaatgaa
ccacaggccttatggttaccgcaacttcagcaaaatttaaaacaggaaattaaccattat
caacaaaaacaacaatatgatgttcaagtattaccaccccaatataaagacattaaacaa
aaattaccacataaaaaacatattttaaacgcagaacataaacatatatttggactatta
gataaaagtaaatatctttgtgttttttgtcaaaaacaatttaatagtgaaatgtatatg
tgcattagttgtaaattaacttgttgtgataattgctcatcaattttaaatataatggat
ttgtaa

DBGET integrated database retrieval system