KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_86266Help
Entry
DICPUDRAFT_86266  CDS       T02090                                 

Definition
delta-aminolevulinate dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DICPUDRAFT_86266
Enzymes [BR:dpp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     DICPUDRAFT_86266
Exosome [BR:dpp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DICPUDRAFT_86266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 330 aa AA seqDB search
MEKKYEHYLHSGYAHPVTRSWQGDNTILKSQLIYPIFVTDLVNTKTEIKSLPGQYQISTD
LVVEFLKPLVEKGLKSVILFGVIISGVKDETASSASNPETSPVIKSIHLIKKEFPEVLII
TDLCLCGYTHHGHCGFLDKEDLIENEPSIVRLGEIAVSFAKAGAHVIAPSDMMDCRVAQI
KKSLFENGLGSRVAVMAYSSKFASSFYGPFRDAAGSGAKKGDRQAYQLPMASRGLGLRAA
LRDEKEGADFIMVKPAGPYMDIIREVKDNVKVPVCCYQVSGEYAMIYHGATAGGINLKEG
VMESLISLQRSGCDIFITYFTPQLLDWLKL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaatatgaacattatttacacagcggttatgcacatccagtaactagatca
tggcaaggagataataccattctcaaatctcaattaatttatccaatttttgttactgat
ttagttaatactaaaaccgaaattaaatcattaccaggacaatatcaaatttcaacagat
ttagttgtagagtttttaaaaccattagtagaaaaaggattaaaatcagttattttattt
ggtgttattatttcaggtgtaaaagacgaaactgcttcatcagcatcaaacccagaaact
tcaccagttattaaatcaattcatttaattaaaaaagaattcccagaggtattaattatt
acagatttatgtttatgcggatacacacatcatggacattgtggatttttagataaagaa
gatttaatcgaaaacgaaccaagtattgttagattaggtgaaattgcagtatcatttgca
aaagcaggagctcatgttattgctccatcagatatgatggattgcagagttgctcaaatt
aaaaaatcattatttgaaaacggtttaggtagtcgtgttgcagttatggcctatagttca
aagtttgcatcatcattttatggaccatttagagatgccgcaggcagtggtgctaaaaag
ggtgatagacaagcctaccaattaccaatggcaagcagaggtttaggtttaagagccgct
ttaagagatgaaaaagaaggtgctgatttcattatggttaaaccagcaggaccatacatg
gatatcatccgtgaagtcaaggataatgtcaaggtcccagtttgttgctatcaagtcagt
ggcgaatatgcaatgatttatcatggtgctactgctggtggtattaacttaaaggaaggt
gttatggagtctttaatctctcttcaacgttctggttgcgacatttttattacatatttt
actcctcaattattagattggttaaaattataa

DBGET integrated database retrieval system