KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_86266Help
Entry
DICPUDRAFT_86266  CDS       T02090                                 

Definition
delta-aminolevulinate dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:dpp00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 330 aa AA seqDB search
MEKKYEHYLHSGYAHPVTRSWQGDNTILKSQLIYPIFVTDLVNTKTEIKSLPGQYQISTD
LVVEFLKPLVEKGLKSVILFGVIISGVKDETASSASNPETSPVIKSIHLIKKEFPEVLII
TDLCLCGYTHHGHCGFLDKEDLIENEPSIVRLGEIAVSFAKAGAHVIAPSDMMDCRVAQI
KKSLFENGLGSRVAVMAYSSKFASSFYGPFRDAAGSGAKKGDRQAYQLPMASRGLGLRAA
LRDEKEGADFIMVKPAGPYMDIIREVKDNVKVPVCCYQVSGEYAMIYHGATAGGINLKEG
VMESLISLQRSGCDIFITYFTPQLLDWLKL
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaaaatatgaacattatttacacagcggttatgcacatccagtaactagatca
tggcaaggagataataccattctcaaatctcaattaatttatccaatttttgttactgat
ttagttaatactaaaaccgaaattaaatcattaccaggacaatatcaaatttcaacagat
ttagttgtagagtttttaaaaccattagtagaaaaaggattaaaatcagttattttattt
ggtgttattatttcaggtgtaaaagacgaaactgcttcatcagcatcaaacccagaaact
tcaccagttattaaatcaattcatttaattaaaaaagaattcccagaggtattaattatt
acagatttatgtttatgcggatacacacatcatggacattgtggatttttagataaagaa
gatttaatcgaaaacgaaccaagtattgttagattaggtgaaattgcagtatcatttgca
aaagcaggagctcatgttattgctccatcagatatgatggattgcagagttgctcaaatt
aaaaaatcattatttgaaaacggtttaggtagtcgtgttgcagttatggcctatagttca
aagtttgcatcatcattttatggaccatttagagatgccgcaggcagtggtgctaaaaag
ggtgatagacaagcctaccaattaccaatggcaagcagaggtttaggtttaagagccgct
ttaagagatgaaaaagaaggtgctgatttcattatggttaaaccagcaggaccatacatg
gatatcatccgtgaagtcaaggataatgtcaaggtcccagtttgttgctatcaagtcagt
ggcgaatatgcaatgatttatcatggtgctactgctggtggtattaacttaaaggaaggt
gttatggagtctttaatctctcttcaacgttctggttgcgacatttttattacatatttt
actcctcaattattagattggttaaaattataa

DBGET integrated database retrieval system