KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_86473Help
Entry
DICPUDRAFT_86473  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 650 aa AA seqDB search
MTTTTKSNNIVGTTTINSNNTNNSNNNNNNNNTSTCKHIIDYKDNGGSNRFNIVQNYIYS
IKMKLLDTTQLPTPYCLECGSFNGRIHICLHCVHASCWKAGHIQQHFNENNGHFLAVDFN
LNQIYCHHCRDYIYDKEFEEIRENVKLNITINLQDVKNPSTKRIKYKSWKPSDEEFQFIK
QNSDIIDYSNPIIGLRGLNNLGNTCFMNSILQSYIHNPLLRNYFLSDMHKCEKKKNLNNY
NYNYNNNNNNNNVNSNSNLVENGIHIKQEPIDSDEQSQQNNNNNNNSLYENNNSKICLGC
EMDKLYTQIFSGLKIPFTPHHFLYSCWNYSSYFVGYEQQDAHEFFISSLNGIHSHCGGTT
GKDCNCIVHCTFGGSLKSEVACLHCQFTSSTSDPFIDISLDIPKSRDLANGNGSAKTTPT
KSDANNDDDNNSENLENGNGIISGNGYHHHQGNTLLACLERFTQPEKLDEKYFCRNCNCK
QESTKQLSFDILPVVICFHLKRFEQSKSNRRTHKIDTFIEFPITIDMTPYTTIARKKNKL
KLQKQETEELNKNNNSSDNDNNNNNNNEESNNSKKRKNRDESDSSFIYELFAVVNHTGKI
DSGHYTCFVKHHDNWYKCDDSMISSTTIHNVLKSKGYLLYYLKKQLEYTK
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgactacaacaacaaaatcaaataatatagttggcaccaccactatcaatagtaataat
accaataatagcaataacaacaacaataataataatacatcaacatgcaaacacataata
gattataaagataatggtggcagtaacagatttaatatagttcaaaattatatatattca
ataaaaatgaaattattagatactactcaattaccgacaccatattgtttagagtgtgga
agttttaatggacgtatacatatatgtttacattgtgtacatgcctcgtgttggaaagca
ggtcatattcagcaacatttcaacgaaaataatggacattttttagcggtcgattttaat
ttaaaccaaatttattgtcatcattgtcgagattatatatacgataaggaatttgaagaa
attagagaaaatgtcaaattaaatataacaattaatttgcaagatgttaaaaatccatca
acaaaacgtataaaatataaaagttggaaaccttcagatgaagaatttcaatttataaag
caaaattcagatattatcgattactcgaatcccatcataggtttaagaggattaaataat
ttaggaaatacgtgttttatgaattcaatattgcaatcatatattcataatccattatta
agaaattattttttaagtgatatgcataaatgtgaaaaaaagaaaaatttaaataattat
aattataattataataataataataataataataatgtaaatagtaatagtaatttagtt
gagaatggtatacatattaaacaagaaccaattgattccgatgaacaatctcaacaaaac
aataataataataataatagtttatatgaaaataataattcaaaaatttgtttaggatgc
gaaatggataaattatatacacaaatatttagtgggttaaagattccatttacacctcat
cattttctatatagttgttggaattattcaagttattttgtaggttacgaacagcaggat
gcacatgaattctttatatcatcactgaatggtattcattctcattgtggtggtacaacc
ggaaaagattgtaattgtattgttcactgtacatttggtggttctttaaaatcggaagta
gcgtgtcttcattgtcaattcacaagttcaacttcagatccattcatagatatttcatta
gatataccaaaatcaagagatctagctaatggtaatggtagtgctaaaacaactccaact
aaatctgatgcaaataatgacgacgataataacagtgaaaatttagaaaatggtaatggt
atcattagcggtaatggttatcatcatcatcaaggtaatactttgttagcttgtttagaa
agatttacacaaccagaaaaattggacgaaaaatatttttgtagaaattgcaattgtaaa
caagaatcaactaaacagctttcctttgatattttacctgtagtaatttgtttccattta
aaaagatttgagcaatcaaaatcaaatagaagaacccataaaattgacacatttatagaa
ttcccaataacaatcgatatgacaccatatacaacaatagctagaaaaaaaaacaaattg
aagcttcaaaaacaagagactgaagaattaaataaaaataataacagtagtgataatgat
aataataataataacaataatgaagaatcaaataatagtaaaaaaagaaaaaatagagat
gagagtgacagctcattcatttacgaattatttgcagttgtaaatcacacaggtaaaatt
gactctggtcactatacatgttttgttaaacatcatgacaattggtataaatgtgatgat
tcaatgattagtagtactacaatacataatgtattgaaatcaaaaggttatcttttatat
tatttaaagaaacaattagaatatacaaaataa

DBGET integrated database retrieval system