KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_86485Help
Entry
DICPUDRAFT_86485  CDS       T02090                                 

Definition
(RefSeq) hypothetical protein
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
dpp00052  Galactose metabolism
dpp00561  Glycerolipid metabolism
dpp00600  Sphingolipid metabolism
dpp00603  Glycosphingolipid biosynthesis - globo and isoglobo series
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    DICPUDRAFT_86485
  Lipid metabolism
   00561 Glycerolipid metabolism
    DICPUDRAFT_86485
   00600 Sphingolipid metabolism
    DICPUDRAFT_86485
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    DICPUDRAFT_86485
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     DICPUDRAFT_86485
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Melibiase_2 Melibiase_2_C Melibiase Glyco_hydro_30C
Motif
Other DBs
NCBI-GeneID: 10507115
NCBI-ProteinID: XP_003284933
JGI: Dicpu1_86485
UniProt: F0ZBX2
Position
Unknown
AA seq 385 aa AA seqDB search
MLLRLSLIVLAFTGLASAINNGLGLTPQMGWNSWNYYACDINETVIMNTALAMSKNGMAA
AGYKYVNIDDCWALERASNGTVIPDPKAFPNGIKYVADYIHSLGLLIGIYTDAGLYTCQK
RPGSYGFEEIDAITYAEWGIDYLKEDWCYSFLENPQERYQIMSNSLNATGRQIFFSLCDW
GTDNPWTFGGAIANSWRTTPDIKDNWDSMMANLMAQASISSYSGVGGWNDPDMLEVGNGG
MTNTEYISHFSLWSILNAPLIAGNNLIDIDQETLSILTATEVIAVNQDPLGVQGALVKSY
NGGLQQIWAKPMADGSRAVVLFNTDTNPATITLNWADIWVAPVTQQLVVRDLWQQSNLGT
FATTFVSEVIPPHGCVMLKLTPATN
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgttattaagattatctttaattgtattagcctttacaggtttagcttctgcaattaat
aatggattgggtttaactcctcaaatgggttggaattcatggaattactatgcatgtgat
attaacgaaacagtaattatgaatactgctcttgcaatgagcaaaaatggtatggctgca
gctggttataaatatgtaaatattgatgattgctgggcacttgaaagagcttcaaatggt
actgttattccagatccaaaagcattcccaaatggtataaaatatgttgccgactatatt
cattcacttggtttacttattggtatttatactgatgccggtctttatacctgtcaaaag
agaccaggcagttatggtttcgaagaaattgatgccattacttatgcagaatggggtatc
gattatttaaaggaagattggtgttattcattccttgaaaacccacaagaaagatatcaa
attatgtcaaattctttaaatgccactggtagacaaatcttctttagtctttgcgattgg
ggtacagataatccatggacatttggtggtgctattgctaactcatggcgtacaactcca
gatattaaagataactgggatagtatgatggcaaatttaatggcccaagctagtatttct
tcttacagtggtgttggtggttggaacgatccagacatgttagaggtaggtaacggtggt
atgaccaatactgaatatatttcacatttctcattatggtccattttgaatgccccatta
atcgctggtaataatttaatcgacattgaccaagaaactttatcaattcttactgccaca
gaggttattgctgttaatcaagatccattaggtgttcaaggtgctcttgtcaaatcctat
aatggtggtttacaacaaatttgggccaaaccaatggctgatggttcaagagctgtcgtt
ctcttcaatactgataccaatccagccaccatcactcttaattgggcagatatctgggtc
gctccagttactcaacaattagtcgttagagatttatggcaacaatccaatcttggtact
tttgcaactacttttgttagtgaagttattccaccacatggttgtgttatgttaaaatta
accccagcaacaaactaa

DBGET integrated database retrieval system