KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_88906Help
Entry
DICPUDRAFT_88906  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:dpp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DICPUDRAFT_88906
   00670 One carbon pool by folate
    DICPUDRAFT_88906
Enzymes [BR:dpp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     DICPUDRAFT_88906
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 218 aa AA seqDB search
MKISIIVAVSKNFVIGSNPKGSKLGELPWHLPKDLKHFKETTHGFPCIIGRLTLEAFGDL
LPNRFNIIVSKKEEFMNLRENKKIDLPEYEKGVTEKGASYVVVPTVEDGIHYADNTLKTD
LVYIVGGKGIYETSQPYTHELIITDIDTHIDDTDVVVYNPFPSEEEKSKWIQVSQHHHPK
DDQNNFDFSITYYKKKEEILINLPPPSPSFLKKHPILK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatcgattattgtagcagtttctaaaaattttgttataggctccaacccaaaa
ggatcaaagcttggtgagttaccatggcatttaccaaaagaccttaaacattttaaagaa
acaactcatggctttccttgtattattggtagattaacacttgaagcatttggtgattta
ttacctaatagatttaacattatagtatcaaagaaagaggagtttatgaaccttagagag
aacaaaaagattgatttaccagaatatgaaaaaggtgtaacagaaaaaggtgcaagttat
gtagtagtaccaacagttgaagacggtattcattatgctgacaatacattaaaaaccgat
ttagtatacattgttggtggtaaaggtatctatgaaacctcacaaccatatacccatgaa
ttaattattacagatatagatacacatatcgatgatacagatgttgtagtttataaccca
ttcccaagcgaagaagagaaatctaaatggattcaagtttcacaacatcaccacccaaaa
gacgatcaaaataactttgatttttcaattacatattataagaaaaaagaagaaatttta
attaatctaccaccaccatcaccatcatttttaaaaaaacacccaattttaaaataa

DBGET integrated database retrieval system