KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_88906Help
Entry
DICPUDRAFT_88906  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:dpp00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:dpp00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 218 aa AA seqDB search
MKISIIVAVSKNFVIGSNPKGSKLGELPWHLPKDLKHFKETTHGFPCIIGRLTLEAFGDL
LPNRFNIIVSKKEEFMNLRENKKIDLPEYEKGVTEKGASYVVVPTVEDGIHYADNTLKTD
LVYIVGGKGIYETSQPYTHELIITDIDTHIDDTDVVVYNPFPSEEEKSKWIQVSQHHHPK
DDQNNFDFSITYYKKKEEILINLPPPSPSFLKKHPILK
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatcgattattgtagcagtttctaaaaattttgttataggctccaacccaaaa
ggatcaaagcttggtgagttaccatggcatttaccaaaagaccttaaacattttaaagaa
acaactcatggctttccttgtattattggtagattaacacttgaagcatttggtgattta
ttacctaatagatttaacattatagtatcaaagaaagaggagtttatgaaccttagagag
aacaaaaagattgatttaccagaatatgaaaaaggtgtaacagaaaaaggtgcaagttat
gtagtagtaccaacagttgaagacggtattcattatgctgacaatacattaaaaaccgat
ttagtatacattgttggtggtaaaggtatctatgaaacctcacaaccatatacccatgaa
ttaattattacagatatagatacacatatcgatgatacagatgttgtagtttataaccca
ttcccaagcgaagaagagaaatctaaatggattcaagtttcacaacatcaccacccaaaa
gacgatcaaaataactttgatttttcaattacatattataagaaaaaagaagaaatttta
attaatctaccaccaccatcaccatcatttttaaaaaaacacccaattttaaaataa

DBGET integrated database retrieval system