KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_89426Help
Entry
DICPUDRAFT_89426  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Brite
Enzymes [BR:dpp01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     DICPUDRAFT_89426
Peptidases [BR:dpp01002]
 Cysteine Peptidases
  Family C86
   DICPUDRAFT_89426
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 206 aa AA seqDB search
MSNNLNVDSLYFERQRKKLCGLHVINNFFQQEKYNQRKLDEIAYEIDISNRLINPHKSFF
GLGNYDANVLVHVFINNDYEIQWFDKRNALEEIDFNMLGGILINTVTFRIFGLYESRHWT
IIKNMDNESSITESTSSTINDPNNLNYVLFDSSNSKPIKISEKSKLINYLKYLQKNSKAE
LILIYKNPIHSNNEKENEKENNNNIK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtccaataatttaaacgttgatagcttatattttgaaagacaaagaaaaaaactatgt
ggtctacatgtaattaataatttttttcaacaagaaaaatataatcaaaggaaattagac
gagatagcgtatgaaattgatatttcaaatagattaatcaatccccataaaagttttttt
ggattaggtaactatgatgcaaatgtactagttcatgtatttataaataacgattatgaa
attcaatggtttgacaaaagaaatgcattagaagagatcgactttaatatgctgggtggg
attttaatcaatactgttacatttaggatatttggtctatatgaatctagacactggact
ataattaaaaatatggataatgaaagctcaataacagaatcaacctcatcaacaataaat
gacccaaataatttaaactatgtcctatttgactcttcaaattcaaaaccaattaaaatt
tcagaaaaatcaaaacttataaactatttaaaatatcttcaaaaaaatagtaaagctgaa
ttaattttaatttataaaaacccaattcatagcaataatgaaaaagaaaatgaaaaagaa
aacaataataatattaaataa

DBGET integrated database retrieval system