KEGG   Dictyostelium purpureum (cellular slime mold): DICPUDRAFT_90584Help
Entry
DICPUDRAFT_90584  CDS       T02090                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
dpp  Dictyostelium purpureum (cellular slime mold)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
Unknown
AA seq 126 aa AA seqDB search
MTWQAYVDSNLIGAGFINAQILSAADGSNWATSKGFTVSATEAAHIIACFKDSSKASSMG
ITINGVKNFVLKADDKSIYAKKDTGGIVIVKTNQCILFGQYDSALQPGSAAKAVESLGDY
LRDSGF
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgacttggcaagcatacgtcgatagcaatttaattggtgctggtttcatcaatgctcaa
attctttcagctgctgatggttcaaactgggctacttcaaaaggtttcactgttagtgcc
accgaagctgctcacattatcgcttgtttcaaagattccagcaaagcctcatcaatgggt
attaccatcaatggtgtcaaaaactttgtattaaaagccgacgataaatcaatttacgct
aaaaaagataccggtggtattgttattgttaaaaccaatcaatgtattttatttggtcaa
tacgattctgctctccaaccaggtagtgccgctaaagctgttgaaagtttaggtgattat
ttacgtgactctggtttctaa

DBGET integrated database retrieval system